KEGG   Enterococcus faecalis OG1RF: OG1RF_10141Help
Entry
OG1RF_10141       CDS       T01882                                 

Gene name
gpmA
Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
efi  Enterococcus faecalis OG1RF
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:efi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    OG1RF_10141 (gpmA)
   01230 Biosynthesis of amino acids
    OG1RF_10141 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OG1RF_10141 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    OG1RF_10141 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    OG1RF_10141 (gpmA)
Enzymes [BR:efi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     OG1RF_10141 (gpmA)
Exosome [BR:efi04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   OG1RF_10141 (gpmA)
  Exosomal proteins of melanoma cells
   OG1RF_10141 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(153728..154414)
Genome map
AA seq 228 aa AA seqDB search
MPKLVFSRHGLSEWNALNQFTGWADVDLAPEGVEEAKEGGRKIKEAGIEFDVAYTSVLTR
AIKTCNYLLEYSDQLWVPQIKSWRLNERHYGKLQGLNKKETAEKYGDEQVHIWRRSYDTL
PPLMEATDEGSAANDRRYAMLDQRDIPGGENLKVTLERALPFWQDEIAPALKDNKTVLVA
AHGNSLRALAKHIEGISDEDIMDLEIPTGKPLVYELNDDLTVKEKYYL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaattagttttttctcgtcatggacttagcgaatggaatgccttaaaccaattt
actggatgggctgacgtagatttagcacctgaaggtgttgaagaagcaaaagaaggcggc
cgtaaaattaaagaagcaggcatcgaattcgacgttgcttatacttctgttttaactcgt
gccatcaaaacttgtaactatttactagaatactcagatcaattatgggtacctcaaatc
aaatcttggcgcttaaacgaacgtcactatggtaaattacaaggactaaacaaaaaagaa
actgctgaaaaatacggagacgaacaagtccacatctggcgtcgttcttacgatactctt
cctccattaatggaagcaacagatgaaggttctgcagcaaacgaccgtcgttatgcaatg
ttagaccaacgcgatattcctggtggcgaaaacttgaaagttactttggaacgtgcatta
ccattctggcaagatgaaattgcgccagctttaaaagacaacaaaactgttttagtagcg
gctcatggtaattcattacgtgctttagctaaacacatcgaaggcatttctgatgaagat
attatggatcttgaaatcccaacaggtaaaccattagtttatgaattaaacgatgattta
actgtgaaagaaaaatactacttataa

DBGET integrated database retrieval system