KEGG   Enterococcus faecalis OG1RF: OG1RF_10141Help
Entry
OG1RF_10141       CDS       T01882                                 

Gene name
gpmA
Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
efi  Enterococcus faecalis OG1RF
Pathway
efi00010  Glycolysis / Gluconeogenesis
efi00260  Glycine, serine and threonine metabolism
efi00680  Methane metabolism
efi01100  Metabolic pathways
efi01110  Biosynthesis of secondary metabolites
efi01120  Microbial metabolism in diverse environments
efi01130  Biosynthesis of antibiotics
efi01200  Carbon metabolism
efi01230  Biosynthesis of amino acids
Module
efi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
efi_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:efi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OG1RF_10141 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    OG1RF_10141 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    OG1RF_10141 (gpmA)
Enzymes [BR:efi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     OG1RF_10141 (gpmA)
Membrane trafficking [BR:efi04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    OG1RF_10141 (gpmA)
Exosome [BR:efi04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   OG1RF_10141 (gpmA)
  Exosomal proteins of melanoma cells
   OG1RF_10141 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AEA92828
Position
complement(153728..154414)
Genome map
AA seq 228 aa AA seqDB search
MPKLVFSRHGLSEWNALNQFTGWADVDLAPEGVEEAKEGGRKIKEAGIEFDVAYTSVLTR
AIKTCNYLLEYSDQLWVPQIKSWRLNERHYGKLQGLNKKETAEKYGDEQVHIWRRSYDTL
PPLMEATDEGSAANDRRYAMLDQRDIPGGENLKVTLERALPFWQDEIAPALKDNKTVLVA
AHGNSLRALAKHIEGISDEDIMDLEIPTGKPLVYELNDDLTVKEKYYL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaattagttttttctcgtcatggacttagcgaatggaatgccttaaaccaattt
actggatgggctgacgtagatttagcacctgaaggtgttgaagaagcaaaagaaggcggc
cgtaaaattaaagaagcaggcatcgaattcgacgttgcttatacttctgttttaactcgt
gccatcaaaacttgtaactatttactagaatactcagatcaattatgggtacctcaaatc
aaatcttggcgcttaaacgaacgtcactatggtaaattacaaggactaaacaaaaaagaa
actgctgaaaaatacggagacgaacaagtccacatctggcgtcgttcttacgatactctt
cctccattaatggaagcaacagatgaaggttctgcagcaaacgaccgtcgttatgcaatg
ttagaccaacgcgatattcctggtggcgaaaacttgaaagttactttggaacgtgcatta
ccattctggcaagatgaaattgcgccagctttaaaagacaacaaaactgttttagtagcg
gctcatggtaattcattacgtgctttagctaaacacatcgaaggcatttctgatgaagat
attatggatcttgaaatcccaacaggtaaaccattagtttatgaattaaacgatgattta
actgtgaaagaaaaatactacttataa

DBGET integrated database retrieval system