KEGG   Enterococcus faecalis OG1RF: OG1RF_10215Help
Entry
OG1RF_10215       CDS       T01882                                 

Gene name
arb
Definition
6-phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
efi  Enterococcus faecalis OG1RF
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:efi00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
224434..225864
Genome map
AA seq 476 aa AA seqDB search
MAFRKDFLWGGATAANQCEGGYNEGGRGLANVDLAPTGPDRFPVITGEKKMFNFDEEHFY
PAQEAIDMYHRYKEDIALFGEMGFKTYRLSIAWSRIFPMGDETEPNEEGLKFYEDLFKEC
HKYGIEPLVTITHFDCPMHLVEEYGAWRSRKLVGFYENLCRVIFNRYKGLVKYWLTFNEI
NMILHAPFMGAGLYFEEGENKEQVKYQAAHHELLASAIATKIAHEVDPENQVGCMLAAGS
NYAYTCKPEDVFAARQADRENYFFIDVQSRGEYPAYALKEMARKGIQIEMEEGDEELLKE
HTVDFISFSYYSSRVTSTDPEINEQTAGNIFASVKNPYLKASEWGWQIDPLGLRITMNDL
YDRYQKPLFIVENGLGAVDTPDENGYVVDDYRIDYLAAHIQAMKDAVEQDGVDLLGYTTW
GCIDLVSAGTGEMKKRYGFIYVDRDNEGNGTLKRSKKKSFDWYKKVIATNGEDLSN
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggcatttagaaaagactttttatggggtggcgcaacagcagccaatcaatgtgaaggc
ggctataacgaaggcggacgtggtttggcaaacgtcgatttagcgccaacgggtccagat
cgttttccagtaatcactggtgaaaagaaaatgtttaactttgatgaggaacatttctat
cctgcacaagaggcgattgatatgtatcatcgctataaagaagatatcgccttgtttggt
gaaatgggttttaaaacataccgtttatccattgcttggagtcgaatttttccaatggga
gatgaaacagagccgaatgaagaaggcttgaagttctatgaagacttattcaaagaatgt
cataaatatgggattgagccactagtaacgattacacactttgactgcccaatgcactta
gtggaagaatatggcgcttggcgtagtcgtaagttagtaggtttctatgaaaatctttgc
cgtgtaattttcaaccgatataaaggattagtcaaatattggttaacatttaacgaaatt
aatatgattttacatgcaccatttatgggagcaggtctatactttgaagaaggcgaaaac
aaagaacaagtgaaataccaagcggcccatcatgaactactagcaagtgcaattgcgaca
aaaattgctcatgaggtagatcctgaaaaccaagtaggttgtatgttagcggctggttcc
aactacgcttatacttgtaaaccagaagatgttttcgctgctcgacaagcagatcgtgaa
aattatttctttattgatgtccaatcacgtggggaataccctgcgtatgctttaaaagaa
atggcacgtaaaggtattcaaattgaaatggaagaaggcgacgaagaacttttaaaagaa
catacggtggacttcatttcgttctcttattattcttctcgtgtcacatcaacagatcca
gaaattaatgaacaaacagctggtaacatctttgcctctgtgaaaaatccttatttaaaa
gccagtgaatggggttggcaaattgatccgcttggtttgagaattacgatgaatgactta
tatgatcgttatcaaaaaccactattcattgttgaaaatggcttaggagcggtagacaca
ccagacgaaaatggttatgtagtcgatgattatcgtatcgattatttggcggcgcatatt
caagcgatgaaagatgccgttgaacaagatggtgtcgacttgttaggctatacgacttgg
ggctgtattgatttagtatcagctggaacaggtgaaatgaaaaaacgctatggctttatc
tatgtggatcgcgataacgaaggaaatggtacgttaaaacgaagcaagaagaaatcgttt
gattggtacaaaaaagtaatcgcaacaaatggtgaagatttaagtaattaa

DBGET integrated database retrieval system