KEGG   Enterococcus faecalis OG1RF: OG1RF_10545Help
Entry
OG1RF_10545       CDS       T01882                                 

Gene name
bgaL
Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
efi  Enterococcus faecalis OG1RF
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:efi00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    OG1RF_10545 (bgaL)
Enzymes [BR:efi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     OG1RF_10545 (bgaL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
573862..575640
Genome map
AA seq 592 aa AA seqDB search
MQTFEIKEDFLLNGQPIKIISGAIHYFRMTPSQWEDSLYNLKALGANTVETYIPWNIHEP
EEGVYDFEGMKNIEAFVRLAEKLNLLVILRPSAYICAEWEFGGLPAWLLKKKGVRLRSTD
PIFMTKVRNYFQVLLPKLAPLQITQGGPVIMMQVENEYGSYGMEKAYLRQTKQIMEELGI
EVPLFTSDGAWEEVLDAGTLIEEDVFVTGNFGSHSKENAAVLKKFMTRHGKKWPLMCMEY
WDGWFNRWGEPVIQREGTDLAKEVKDMLAVGSLNLYMFHGGTNFGFYNGCSARGAKDLPQ
VTSYDYDALLTEAGEPTEKYYAVQKAIKEVCPEVWQAQPRTKKLGNLGSFPVTASVSLFA
VKDQMMTPKTTVYPLSMEEAGSGYGYLLYSFDLKNYHHENKLKVVEASDRLHIYVDGDLA
ATQYQETVGEELLISGQTEKDTLALDILVENLGRVNYGFKLNNPTQSKGIRGGVMQDIHF
HQGCQHYPLTFSQEQLAKIDYTAGKNPLQPSFYQVTFELEQLADTYIDCRGYGKGFVVVN
GHHLGRYWEIGPIHSLYCPKEFLQQGQNEVVIFETEGIEIEYLKFTNQVIID
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacgtttgagattaaagaagactttttattaaatggacaaccaataaaaattatt
agcggggcgattcattactttcgaatgacacctagccaatgggaagatagcctctataat
ctgaaagctttaggagctaatacagtagaaacctacattccttggaatattcatgaacca
gaagaaggcgtatacgattttgaaggaatgaaaaacattgaagcatttgtccgcttggca
gaaaaactgaatttactagttattctgcgtccttcggcttatatttgtgcagaatgggag
tttggtggcttaccagcatggcttttgaaaaaaaaaggtgtacggttacgttcgacagat
cctatttttatgactaaagttcgtaactattttcaagtattattgcctaaactagcaccg
ctgcagataacacaaggtggaccagtgatcatgatgcaggttgaaaatgaatatgggtcc
tatggcatggagaaagcgtacttgcgacaaaccaagcagataatggaagaactggggatt
gaggttcctctttttacatctgatggcgcttgggaagaggttttggatgcggggacgtta
attgaagaggatgtttttgtgacaggaaattttggtagtcattcgaaagaaaatgctgcc
gttttgaaaaaatttatgactcgtcatggtaaaaaatggccgttgatgtgcatggaatac
tgggatgggtggttcaatcgttggggcgaaccagtgattcagcgggaaggtaccgacttg
gcgaaagaagtaaaagatatgctggcagtgggttctttaaatctctatatgtttcatgga
ggaacaaatttcggcttttataacgggtgttcggcgcgaggtgcaaaagatttacctcaa
gtcactagctatgattatgatgctttattaacagaagcaggagaaccaacagaaaaatat
tatgccgttcaaaaagcaattaaagaagtatgtccagaagtttggcaagcacaaccacgc
acgaaaaaactggggaatttaggaagctttccagtaactgctagcgtatccttattcgca
gtaaaagatcaaatgatgacaccgaagaccaccgtgtatccattaagtatggaagaagct
ggctcaggctatggctacttgctttattcgtttgatttaaaaaattatcatcatgaaaat
aaactaaaagtggtcgaggccagtgatcgtttacacatttatgtagatggagatttagct
gctacccaatatcaagagacagtgggagaagagctactgatttcagggcaaactgaaaaa
gacacacttgcgttagatatcttagtggaaaatttaggtcgcgttaattatggctttaaa
ttaaataatccgacacaaagtaaaggaattcgaggtggagtgatgcaagacattcatttt
caccaaggctgtcaacactatcccttaactttttcacaagagcaattagccaagattgat
tacacagctggaaaaaatccattgcagccttcattttatcaagtaacatttgaattagaa
cagctagcagacacgtatattgactgtcgaggctacggcaaaggattcgttgtggtcaat
ggtcatcatctaggtcgttattgggaaataggacccattcattcgctgtattgtcccaaa
gaatttttacagcaaggacaaaatgaagtagtaatttttgaaacagagggaattgaaatt
gagtacttgaaatttacgaatcaagtaatcatagattaa

DBGET integrated database retrieval system