KEGG   Enterococcus faecalis OG1RF: OG1RF_10627Help
Entry
OG1RF_10627       CDS       T01882                                 

Gene name
aad
Definition
(RefSeq) aldehyde-alcohol dehydrogenase (EC:1.1.1.1 1.2.1.10)
  KO
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
efi  Enterococcus faecalis OG1RF
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:efi00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    OG1RF_10627 (aad)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OG1RF_10627 (aad)
   00620 Pyruvate metabolism
    OG1RF_10627 (aad)
   00650 Butanoate metabolism
    OG1RF_10627 (aad)
  Lipid metabolism
   00071 Fatty acid degradation
    OG1RF_10627 (aad)
  Amino acid metabolism
   00350 Tyrosine metabolism
    OG1RF_10627 (aad)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    OG1RF_10627 (aad)
   00626 Naphthalene degradation
    OG1RF_10627 (aad)
Enzymes [BR:efi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     OG1RF_10627 (aad)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     OG1RF_10627 (aad)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
663189..665792
Genome map
AA seq 867 aa AA seqDB search
MNMVKTVKKEKTETVDVSSMIDELATKANVALKAMEDFTQEQVDHIVHQMAMAALDQHMP
LAKMAVEETGRGIYEDKAIKNMYASEYIWNNIKHDKTVGVINKDEQTGLMEIAEPVGVVC
GVTPTTNPTSTTIFKSLIALKTRNPIVFAFHPSAQKCSAEAARIVRDAAIAAGAPENCIQ
WIEQPSIDATSALMNHPGIAIVLATGGAGMVKSAYSTGKPALGVGPGNVPAYIEKTAKVK
RAVNDLIVSKSFDNGMICASEQAVIVDKEIYASVKAEFEAHNVYFVKPNELQKLEDAVMN
EGKYAVNPAIVGNSAEKIAELAGISVPKGTKILVAELEGAGPEYPLSREKLSPVLAMMKS
NNAEHAFELCEAMLNLGGLGHTAVIHTEDEELQVAFGLRMKACRILVNTPSAEGGIGNIY
NEMIPSLTLGCGSYGKNSVSKNVSAINLINIKTVAKRRNNMQWFKLPPKIFFEKNSLQYL
QKMENVERVMLVCDPGMVQFGYADIVRKELQKRKNDVKIEVFSDVEPNPSTNTVYAGTKM
MVDFQPDTVIALGGGSAMDAAKGMWMFYEHPDTEFFGAKQKFLDIRKRTYKIAKPEKTQF
VCIPTTSGTGSEVTPFAVITDSETHVKYPLADYALTPDVAIVDPQFVMSVPASVTADTGM
DVLTHAIESYVSVMASDYTRGLSLQAIKLVFDHLENSVKRPDMESREKMHNASTMAGMAF
ANAFLGICHSIAHKIGGEYGIPHGRTNAILLPHIIRYNAKDPSKHAMFPKYDYFRADTDY
ADIAKFLGLKGNTTAELVEALATAVADLGKSVGIDMNLKAQGVSQETLDTTVDRMAELAY
EDQCTTANPKEPLISELKQIILDAYVG
NT seq 2604 nt NT seq  +upstreamnt  +downstreamnt
atgaacatggttaaaacagtaaaaaaagaaaagacagaaacagttgatgtttcatcaatg
attgatgaattagcaacaaaagcgaatgtcgctttaaaagcaatggaagattttacacaa
gaacaagtagatcacattgtccatcaaatggcgatggcggcgttagaccaacatatgcct
ttagcaaaaatggctgtcgaagaaactggccgtggaatctatgaagataaagcaatcaaa
aatatgtatgcatctgaatacatttggaataatattaaacatgataaaacagtgggtgta
attaacaaagacgaacaaaccggcttaatggaaattgctgagccagttggcgtggtatgt
ggggtcacaccaacaacgaacccaacgtcaacaactatttttaaatcactaattgcctta
aaaacaagaaatccaattgtttttgctttccatcctagcgcacaaaaatgttcggcagaa
gcggcacgtattgtacgggatgcggcgattgcagcaggtgcaccagaaaattgtattcaa
tggattgaacaaccatcgattgatgcaacatctgctttgatgaatcatccagggattgcc
attgttttagcaactggtggcgcaggcatggtaaaatctgcatactcaacaggtaaacca
gcactaggcgttggtcctgggaacgtaccagcttatattgaaaaaacggctaaagtaaaa
cgtgcggttaatgatttaattgtttcaaaatcatttgataatggaatgatttgtgcttct
gagcaagcggtcattgtggataaagaaatttatgcttctgtcaaagctgagtttgaagca
cacaatgtttacttcgtgaaaccgaatgaattacaaaaactagaagatgcagtgatgaat
gaaggcaaatacgcagtaaatccagcgattgtcggtaactctgcagaaaaaattgctgaa
ttagcaggaattagcgtaccaaaaggcacaaaaattttagtcgctgaattagaaggtgca
ggtccagaatatccattatcaagagaaaaattatcgccagttttagcaatgatgaaatca
aacaatgcagagcatgcttttgaactatgtgaagcgatgttaaacttaggtggtttagga
catacagcagtaattcatacagaagatgaagagttacaagttgcttttggtttacgtatg
aaagcttgtcgtattttagtgaatactccatcagcagaaggcggtatcggtaacatttat
aacgaaatgattccatccttaacacttggttgtggttcatacgggaaaaactctgtttct
aaaaacgtatcagccattaacttaattaatattaaaacggtagcgaaacggagaaataat
atgcaatggtttaaattacctccaaaaattttctttgaaaaaaattctttacaatatcta
caaaaaatggaaaatgttgaacgtgtcatgttagtttgtgacccaggtatggttcaattt
ggctatgcagatatcgtacgtaaagagctacaaaaacgtaaaaatgatgtgaaaatcgaa
gtattttctgatgttgaaccaaacccatcaacaaatactgtttatgcaggtaccaaaatg
atggttgatttccaaccagatacagtgattgccttgggtggcggttctgcaatggatgcg
gcgaaaggcatgtggatgttctatgaacacccagatacagagttctttggtgcaaaacaa
aaattcttagatatccgcaaacggacatataaaattgccaaaccagaaaaaacacaattt
gtttgtatcccaactacttcaggaactggttcagaagttacaccatttgccgttattact
gatagtgaaacacacgtgaaatatccgttagcagactatgcgttaacaccagatgtagcg
attgttgatccacagttcgtaatgtctgtgccagcttcagtcactgcagatacaggtatg
gatgttttaacacatgctattgaatcttatgtttccgtgatggcttcagattacacacgt
ggtttaagtttacaagcaatcaagttagttttcgatcatttagaaaattcagtgaaacgt
ccagatatggaatctcgcgaaaaaatgcataatgcatcaaccatggcagggatggcattt
gccaatgcattcttaggtatttgtcactctattgctcataaaattggtggggaatatggc
attccacatggtcgtacaaatgcgattttattaccacatattattcgttacaatgcgaaa
gatccatcaaaacacgcaatgttccctaaatatgattacttccgcgccgatactgattat
gcagacattgcaaaattcttaggcttaaaaggaaatactaccgcagaattagtagaagct
ttagcaacagcagtagcagacttaggtaaatcagtcggaattgacatgaacttgaaagcc
caaggtgtctcacaagaaacattagacacaacggttgatcgtatggcagaacttgcatat
gaagaccaatgtacaactgcaaatccgaaagaaccattaattagtgaactaaaacaaatt
atcttagatgcttatgtaggataa

DBGET integrated database retrieval system