KEGG   Enterococcus faecalis OG1RF: OG1RF_11143Help
Entry
OG1RF_11143       CDS       T01882                                 

Gene name
aceF
Definition
(GenBank) pyruvate dehydrogenase complex E2, dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
efi  Enterococcus faecalis OG1RF
Pathway
efi00010  Glycolysis / Gluconeogenesis
efi00020  Citrate cycle (TCA cycle)
efi00620  Pyruvate metabolism
efi01100  Metabolic pathways
efi01110  Biosynthesis of secondary metabolites
efi01120  Microbial metabolism in diverse environments
efi01130  Biosynthesis of antibiotics
efi01200  Carbon metabolism
Module
efi_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:efi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OG1RF_11143 (aceF)
   00020 Citrate cycle (TCA cycle)
    OG1RF_11143 (aceF)
   00620 Pyruvate metabolism
    OG1RF_11143 (aceF)
Enzymes [BR:efi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     OG1RF_11143 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding GCV_H HlyD_3 HlyD_D23 RnfC_N
Motif
Other DBs
NCBI-ProteinID: AEA93830
Position
1193212..1194831
Genome map
AA seq 539 aa AA seqDB search
MAYQFKLPDIGEGIAEGEIVKWFVKPGDTINEDDTLLEVQNDKSVEEIPSPVTGTVKNIV
VPEGTVANVGDVLIEIDAPGHEDNDAAPAAPAQEQTPAQPAAVPTTEAAGGFFQFKLPDI
GEGIAEGEIVKWFVKAGDTINEDDSLLEVQNDKSVEEIPSPVTGTVKNIVVPEGTVANVG
DVLVEIDAPGHNSAAPAAAAPATDAPKAEASAPAASTGVVAAADPNKRVLAMPSVRQYAR
EKDVDITQVTATGKGGRVIKADIDAFVSGGSQAAPATEAAATEAAPKAEAAAPKAAPKAF
TSDLGEMETREKMTPTRKAIAKAMVNSKHTAPHVTLHDEVEVSKLWDHRKKFKDVAAANG
TKLTFLPYVVKALTSTVQKFPILNASIDDAAQEIVYKNYFNIGIATDTDHGLYVPNVKNA
NTKSMFAIADEINEKAALAIEGKLTAQDMRDGTITISNIGSVGGGWFTPVINYPEVAILG
VGTIAQEPVVNADGEIVVGRMMKLSLSFDHRIVDGATAQKAMNNIKRLLADPELLLMEG
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atggcttatcagtttaaattaccggatatcggtgaagggattgccgaaggcgaaatcgtt
aaatggtttgtaaaacctggcgatacaatcaacgaagacgatacgttattagaagtacaa
aatgacaaatcagtggaagaaattccatcaccagtaacaggtactgtaaaaaatatcgtt
gtaccagaaggaacagttgcaaacgttggtgacgtgttaatcgaaatcgacgcacctggt
cacgaagataacgatgcagcaccagcagctcctgcacaagaacaaacaccagcacaacct
gctgctgtaccaacaaccgaagcagctggcggatttttccaattcaaattaccagacatc
ggtgaaggaattgccgaaggcgaaatcgttaaatggttcgttaaagcgggcgacacaatt
aatgaagatgattcattattagaagtacaaaatgacaaatcagtagaagaaattccatca
ccagtaacaggtactgtaaaaaatatcgttgtaccagaaggaacagttgccaatgtgggt
gacgtgttagttgaaattgacgcacctggtcataattcagcagcaccggcagccgcagca
ccagctactgacgctcctaaagcggaagcatcagctccagccgcttcaacaggcgtagtt
gcagccgctgatccaaacaaacgcgttttagcaatgccatctgttcgtcagtatgcgcgt
gaaaaagacgttgatattacacaagtaactgcaactggtaaaggtggccgtgtcattaaa
gcggatattgatgcctttgtttctggtggctctcaagcagcaccagctactgaagctgcc
gcaacagaagcagcacctaaagcggaagcagctgcacctaaagcagcgccaaaagccttt
acttctgatttaggcgaaatggaaacacgtgaaaaaatgacaccaacacgtaaagcaatt
gctaaagcaatggttaacagcaaacacactgctcctcacgtaacattacatgatgaagta
gaagtttctaaattatgggatcaccgtaagaaatttaaagatgttgctgctgcaaatggt
acaaaattaacattcttaccatacgttgtaaaagcattgacttcaactgttcaaaaattc
ccaatcttgaatgcatcaattgatgacgcagcacaagaaattgtttacaaaaattacttt
aacattggtatcgctactgatacagatcatggcttatatgtaccaaatgttaaaaatgct
aatacgaagagcatgtttgctatcgctgatgaaatcaacgaaaaagcagcattggctatc
gaaggcaaattaactgcacaagatatgcgtgatggtacaatcacaattagtaacattggt
tcagtcggtggcggctggtttacaccagtaatcaactaccctgaagttgctattttaggc
gttggtacaattgcacaagaaccagttgttaatgcagacggcgaaatcgttgtgggacgc
atgatgaaattatcattaagctttgaccaccgtatcgttgacggcgcaactgctcaaaaa
gcaatgaacaacattaaacgcttattagctgatccagaattactattaatggaaggatga

DBGET integrated database retrieval system