KEGG   Enterococcus faecalis OG1RF: OG1RF_11220Help
Entry
OG1RF_11220       CDS       T01882                                 

Gene name
fbp
Definition
fructose-1,6-bisphosphatase (EC:3.1.3.11)
Orthology
K04041  
fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
efi  Enterococcus faecalis OG1RF
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:efi01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:efi00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:efi00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:efi00051]
Metabolism; Energy metabolism; Methane metabolism [PATH:efi00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1275132..1277012)
Genome map
AA seq 626 aa AA seqDB search
MATLNRDQQIEEIINLEAILNLPKGTEHFVSDLHGEFEAFDHILRNGSGRIREKVQFLFK
QELNAHQMDELCFIIYYPEEKLTLLENESALSYEWWLLTIRRLVEIVRSSSMKYTRSKVR
KALPETYGYILEELIYQYDETTTKNGYYQQIIEKIILLGEAKRFVTELAYLIQRLIIDHL
HVIGDIYDRGPAPDKIMDRLMSYHSLDIQLGNHDMIWLAAYSGSLACLANVVRICARYGN
LDLLEERYAIDLTALKKFSLETYKENPAFAPKKNPYRALTEAEKQVAMRVQQAIAIIQEK
LEGQIIGRRPDFNLAHRLRLDKIQGETITFDECRYTLINSCFQTVSEEQPYQLTREEKQI
IDDLLTQFQSSPRLTKHMRFLMEKASLYLVYNQNLLIHGCLPLNADGTFQAYTFKGHSYS
GKALVDFFQEMLEEAYAQPASTDDYATDCLWYLWCGEGSSLFGKRAMKTFERYFLAEKET
HHEEKNPYYSLRDTVEVCERILDEFEVTGENRHIINGHTPVKRTKGESPIKANGTLLVID
GGFSKSYQTITGIAGYTLLYNSFGLQLTAHKSFSSKETAILNNQDIHSIKQVIDRPLQRL
LVKDTTIGKELLKQSQALQKQMKQNQ
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
ttggctacactgaaccgcgatcaacaaattgaagaaattattaatttggaagcaattttg
aatttaccgaaaggaacagaacattttgtcagtgatttacatggtgaatttgaagctttt
gaccatattttaagaaatggttctgggcgaatcagagaaaaagttcaatttttatttaaa
caagaattaaatgcccatcagatggacgagctttgttttattatctactatccagaagaa
aaattaacacttttagaaaatgaaagcgccctctcttatgaatggtggctattaacgatt
cgccgtctggttgaaatcgtccgttcttcttcgatgaagtacacacgttctaaagttcgc
aaagcccttcctgaaacctatgggtatattctcgaagaattgatttatcaatatgatgaa
acaacaaccaaaaacggttactatcaacaaattattgaaaaaattattttactaggtgaa
gccaaacgtttcgtaacagaattagcttatctaatccaacgtctgattatcgatcaccta
catgttattggggatatctatgaccgggggccagcaccagataaaattatggaccgatta
atgtcctatcactccttggatattcaactaggcaatcatgatatgatttggctggctgct
tatagtggttcactggcttgtttagccaatgtagtacgtatttgtgctcgctatggaaat
ttagatttgttagaagaacgttatgctatcgatttaaccgccttaaaaaaatttagttta
gaaacgtataaagaaaatcctgcttttgcacccaagaaaaatccctatcgtgcgttaact
gaagctgaaaaacaagtagcgatgcgtgtgcaacaagccattgccattattcaagaaaaa
ctagaaggccaaattattggtcgacgccctgattttaacttggcacatcggctacgctta
gataagattcaaggggaaactattacttttgacgaatgtcgttatacattaattaacagc
tgtttccaaaccgtttctgaagagcaaccttaccaattaacacgtgaggaaaaacagata
attgatgatttattaacgcaatttcagtcttcgccgcggttaacaaaacacatgcgcttt
ctaatggaaaaagcttctctttaccttgtgtataatcaaaatttattgattcatggctgt
ctgcctctgaatgcggacggtacttttcaagcttatacatttaaaggccactcctattca
ggaaaagctttagttgacttctttcaggaaatgttagaagaagcttatgctcagcctgct
agtacagatgactatgcaacagattgtttatggtatctttggtgtggcgaaggttcctca
ttatttggcaaacgagctatgaaaaccttcgagcgttattttctcgctgaaaaagaaaca
catcatgaagaaaagaatccttactactctttgcgtgatacggttgaagtttgtgaaaga
atcctagatgaatttgaagtgactggtgaaaatagacatatcattaatggccatacacca
gttaaacgaacaaaaggcgaatcgccaatcaaagcaaatggcacgcttctcgtaattgac
ggcggcttttcaaaatcttatcagacaattactggaattgctggttatacattgttgtac
aactcgtttggtttacaactgaccgcgcataaatctttttctagtaaagaaacagccatt
ttaaataatcaagacattcattccatcaaacaagtcatcgatcgccccttacagcggtta
ttggtgaaagataccactatcggcaaagagctattaaagcaatcgcaagcactccaaaaa
caaatgaaacaaaaccagtag

DBGET integrated database retrieval system