KEGG   Enterococcus faecalis OG1RF: OG1RF_11220Help
Entry
OG1RF_11220       CDS       T01882                                 

Gene name
fbp
Definition
(GenBank) fructose-1,6-bisphosphatase
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
efi  Enterococcus faecalis OG1RF
Pathway
efi00010  Glycolysis / Gluconeogenesis
efi00030  Pentose phosphate pathway
efi00051  Fructose and mannose metabolism
efi00680  Methane metabolism
efi01100  Metabolic pathways
efi01110  Biosynthesis of secondary metabolites
efi01120  Microbial metabolism in diverse environments
efi01130  Biosynthesis of antibiotics
efi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:efi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OG1RF_11220 (fbp)
   00030 Pentose phosphate pathway
    OG1RF_11220 (fbp)
   00051 Fructose and mannose metabolism
    OG1RF_11220 (fbp)
  Energy metabolism
   00680 Methane metabolism
    OG1RF_11220 (fbp)
Enzymes [BR:efi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     OG1RF_11220 (fbp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2
Motif
Other DBs
NCBI-ProteinID: AEA93907
Position
complement(1275132..1277012)
Genome map
AA seq 626 aa AA seqDB search
MATLNRDQQIEEIINLEAILNLPKGTEHFVSDLHGEFEAFDHILRNGSGRIREKVQFLFK
QELNAHQMDELCFIIYYPEEKLTLLENESALSYEWWLLTIRRLVEIVRSSSMKYTRSKVR
KALPETYGYILEELIYQYDETTTKNGYYQQIIEKIILLGEAKRFVTELAYLIQRLIIDHL
HVIGDIYDRGPAPDKIMDRLMSYHSLDIQLGNHDMIWLAAYSGSLACLANVVRICARYGN
LDLLEERYAIDLTALKKFSLETYKENPAFAPKKNPYRALTEAEKQVAMRVQQAIAIIQEK
LEGQIIGRRPDFNLAHRLRLDKIQGETITFDECRYTLINSCFQTVSEEQPYQLTREEKQI
IDDLLTQFQSSPRLTKHMRFLMEKASLYLVYNQNLLIHGCLPLNADGTFQAYTFKGHSYS
GKALVDFFQEMLEEAYAQPASTDDYATDCLWYLWCGEGSSLFGKRAMKTFERYFLAEKET
HHEEKNPYYSLRDTVEVCERILDEFEVTGENRHIINGHTPVKRTKGESPIKANGTLLVID
GGFSKSYQTITGIAGYTLLYNSFGLQLTAHKSFSSKETAILNNQDIHSIKQVIDRPLQRL
LVKDTTIGKELLKQSQALQKQMKQNQ
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
ttggctacactgaaccgcgatcaacaaattgaagaaattattaatttggaagcaattttg
aatttaccgaaaggaacagaacattttgtcagtgatttacatggtgaatttgaagctttt
gaccatattttaagaaatggttctgggcgaatcagagaaaaagttcaatttttatttaaa
caagaattaaatgcccatcagatggacgagctttgttttattatctactatccagaagaa
aaattaacacttttagaaaatgaaagcgccctctcttatgaatggtggctattaacgatt
cgccgtctggttgaaatcgtccgttcttcttcgatgaagtacacacgttctaaagttcgc
aaagcccttcctgaaacctatgggtatattctcgaagaattgatttatcaatatgatgaa
acaacaaccaaaaacggttactatcaacaaattattgaaaaaattattttactaggtgaa
gccaaacgtttcgtaacagaattagcttatctaatccaacgtctgattatcgatcaccta
catgttattggggatatctatgaccgggggccagcaccagataaaattatggaccgatta
atgtcctatcactccttggatattcaactaggcaatcatgatatgatttggctggctgct
tatagtggttcactggcttgtttagccaatgtagtacgtatttgtgctcgctatggaaat
ttagatttgttagaagaacgttatgctatcgatttaaccgccttaaaaaaatttagttta
gaaacgtataaagaaaatcctgcttttgcacccaagaaaaatccctatcgtgcgttaact
gaagctgaaaaacaagtagcgatgcgtgtgcaacaagccattgccattattcaagaaaaa
ctagaaggccaaattattggtcgacgccctgattttaacttggcacatcggctacgctta
gataagattcaaggggaaactattacttttgacgaatgtcgttatacattaattaacagc
tgtttccaaaccgtttctgaagagcaaccttaccaattaacacgtgaggaaaaacagata
attgatgatttattaacgcaatttcagtcttcgccgcggttaacaaaacacatgcgcttt
ctaatggaaaaagcttctctttaccttgtgtataatcaaaatttattgattcatggctgt
ctgcctctgaatgcggacggtacttttcaagcttatacatttaaaggccactcctattca
ggaaaagctttagttgacttctttcaggaaatgttagaagaagcttatgctcagcctgct
agtacagatgactatgcaacagattgtttatggtatctttggtgtggcgaaggttcctca
ttatttggcaaacgagctatgaaaaccttcgagcgttattttctcgctgaaaaagaaaca
catcatgaagaaaagaatccttactactctttgcgtgatacggttgaagtttgtgaaaga
atcctagatgaatttgaagtgactggtgaaaatagacatatcattaatggccatacacca
gttaaacgaacaaaaggcgaatcgccaatcaaagcaaatggcacgcttctcgtaattgac
ggcggcttttcaaaatcttatcagacaattactggaattgctggttatacattgttgtac
aactcgtttggtttacaactgaccgcgcataaatctttttctagtaaagaaacagccatt
ttaaataatcaagacattcattccatcaaacaagtcatcgatcgccccttacagcggtta
ttggtgaaagataccactatcggcaaagagctattaaagcaatcgcaagcactccaaaaa
caaatgaaacaaaaccagtag

DBGET integrated database retrieval system