KEGG   Enterococcus faecalis OG1RF: OG1RF_11457Help
Entry
OG1RF_11457       CDS       T01882                                 

Gene name
cap4C
Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
efi  Enterococcus faecalis OG1RF
Pathway
efi00040  Pentose and glucuronate interconversions
efi00052  Galactose metabolism
efi00500  Starch and sucrose metabolism
efi00520  Amino sugar and nucleotide sugar metabolism
efi01100  Metabolic pathways
efi01130  Biosynthesis of antibiotics
Module
efi_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:efi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    OG1RF_11457 (cap4C)
   00052 Galactose metabolism
    OG1RF_11457 (cap4C)
   00500 Starch and sucrose metabolism
    OG1RF_11457 (cap4C)
   00520 Amino sugar and nucleotide sugar metabolism
    OG1RF_11457 (cap4C)
Enzymes [BR:efi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     OG1RF_11457 (cap4C)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD
Motif
Other DBs
NCBI-ProteinID: AEA94144
Position
complement(1518017..1518913)
Genome map
AA seq 298 aa AA seqDB search
MKVKKAVIPAAGLGTRFLPATKAMAKEMLPIVDKPTIQFIVEEALASGIEDILIVTGKAK
RPIEDHFDSNVELENNLKEKNKTDLLKLVEETTDVNLHFIRQSHPKGLGHAVLQAKAFVG
NEPFVVMLGDDLMEDKVPLTKQLMDDYEQTHASTIAVMKVPHEDTSKYGIINPEKEIEKG
LYNVENFVEKPKPEEAPSDLAIIGRYLLTPEIFDVLENQKPGAGNEIQLTDAIDTLNKTQ
RVFAREFKGERYDVGDKFGFMKTSIEYGLTHPEVKDNLREYIINLGAQLAKKEQPKEK
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttaaaaaggcagttattccagcagctgggttaggaacacgtttcttgccggct
accaaagcgatggcaaaagaaatgttaccgattgttgataaaccaacgattcaatttatt
gtagaagaagcactagcttcaggaatcgaagatattttaattgtgacaggcaaagccaaa
cgtccgattgaagatcatttcgattcaaatgttgaattagaaaataacttaaaagaaaaa
aataaaaccgatttattgaaattagtcgaagaaacaacggatgttaatttacattttatt
cgtcaatcccatccgaaaggcttaggacacgctgttttacaagcgaaagcatttgttggc
aatgaaccttttgtcgtgatgttaggcgacgatttaatggaagataaagtgccattaacg
aaacaattaatggatgattacgaacaaacacatgcttcgacaattgcggtaatgaaagta
ccccatgaagatacttcaaaatatggtattatcaacccagaaaaagaaatcgaaaaagga
ctatacaatgtcgagaattttgttgaaaaaccaaaacccgaggaagcaccaagtgattta
gcgattatcggccgttatttattaacccctgaaatttttgatgtacttgaaaatcaaaaa
ccaggcgctggtaacgaaattcagttaacagatgcgattgacactttaaataaaacacaa
cgcgtttttgctcgtgagtttaaaggagaacgttacgacgttggcgataaatttgggttt
atgaaaacaagcattgaatatggtttgactcatccagaagtaaaagataatttacgagaa
tacattattaatttaggtgctcaattagcgaaaaaagagcaaccaaaagaaaaataa

DBGET integrated database retrieval system