KEGG   Enterococcus faecalis OG1RF: OG1RF_11533Help
Entry
OG1RF_11533       CDS       T01882                                 

Gene name
adhA
Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
efi  Enterococcus faecalis OG1RF
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:efi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OG1RF_11533 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    OG1RF_11533 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    OG1RF_11533 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    OG1RF_11533 (adhA)
   00626 Naphthalene degradation
    OG1RF_11533 (adhA)
Enzymes [BR:efi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     OG1RF_11533 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1601200..1602249)
Genome map
AA seq 349 aa AA seqDB search
MIHNRNKEERTMYKAIVAAKGKTTKIVEKESRPLKDNEARLKMEVCGVCHTDLHVKNADF
GDVSGCTLGHEGIGIVTEVGKDVTSLKIGDRASVAWFYEGCGHCEYCTSGRETLCRSVKN
AGYTVDGAMAEECIVTDGYAVKVPENLASEPASSITCAGVTTYKAIKESGIRPGQWLMIS
GLGGLGNLALQYAKHVFNAKVVAVDVNDNQLTFAKEMGADLLINPVKDPDFAAQLQKEIG
GVHAAVVTAVAKSAFNGAVDAVRAGGTVVAVGLPVETMDLSIPRLVLDGIHVVGSLVGTR
QDLREAFQFGAEGKVVPVCQTRQPEEINAIFEEMEQGKIRGRMVIDFRS
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgattcacaatagaaacaaggaggaaagaaccatgtataaagcaattgtcgcagcaaaa
ggaaaaacaacaaaaattgttgaaaaagaatcgcgtccattgaaagataatgaagcgcgg
ttgaaaatggaagtctgtggtgtctgtcatacggatttacacgttaagaatgcagatttt
ggcgatgttagcggttgtaccttaggtcacgaaggaattgggattgtgacggaggttgga
aaagacgttactagtttaaagattggtgatcgtgcatctgttgcatggttttatgaaggc
tgcgggcattgcgaatattgtacttctggtcgagaaacgctttgtcgttcagtaaaaaat
gctggatatacagttgatggtgccatggccgaagaatgcatcgtcacagacggttatgca
gtgaaagtgccagaaaatttagcatcagagccagcttcctctattacttgtgcaggggta
acaacctacaaagcgataaaagaatctgggattcgtccaggtcaatggctaatgatttca
ggattaggtgggctaggtaatctagctttacaatatgccaagcatgtctttaatgcaaaa
gtagtagctgttgatgtgaatgataatcagttaacttttgcgaaagaaatgggtgctgat
cttttaattaatccagttaaagatcctgattttgctgcacaacttcaaaaagaaattggc
ggtgtccatgcagcagtagtcactgcggtagctaaatcagcatttaatggcgcagtcgat
gcagtccgtgcgggaggaacggttgtcgccgttggattgcctgttgagacaatggattta
tctattccacgtcttgttcttgatggcattcacgtagtcggatcgttagttggaacccgt
caagatttaagagaagctttccaattcggtgcagaaggaaaagttgttcctgtttgtcaa
acacgccaaccagaagaaattaatgctatttttgaagaaatggaacaaggaaaaattcgc
gggcgcatggtcattgattttcgcagttaa

DBGET integrated database retrieval system