KEGG   Enterococcus faecalis OG1RF: OG1RF_11533Help
Entry
OG1RF_11533       CDS       T01882                                 

Gene name
adhA
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
efi  Enterococcus faecalis OG1RF
Pathway
Glycolysis / Gluconeogenesis
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:efi00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    OG1RF_11533 (adhA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OG1RF_11533 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    OG1RF_11533 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    OG1RF_11533 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    OG1RF_11533 (adhA)
   00626 Naphthalene degradation
    OG1RF_11533 (adhA)
Enzymes [BR:efi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     OG1RF_11533 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1601200..1602249)
Genome map
AA seq 349 aa AA seqDB search
MIHNRNKEERTMYKAIVAAKGKTTKIVEKESRPLKDNEARLKMEVCGVCHTDLHVKNADF
GDVSGCTLGHEGIGIVTEVGKDVTSLKIGDRASVAWFYEGCGHCEYCTSGRETLCRSVKN
AGYTVDGAMAEECIVTDGYAVKVPENLASEPASSITCAGVTTYKAIKESGIRPGQWLMIS
GLGGLGNLALQYAKHVFNAKVVAVDVNDNQLTFAKEMGADLLINPVKDPDFAAQLQKEIG
GVHAAVVTAVAKSAFNGAVDAVRAGGTVVAVGLPVETMDLSIPRLVLDGIHVVGSLVGTR
QDLREAFQFGAEGKVVPVCQTRQPEEINAIFEEMEQGKIRGRMVIDFRS
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgattcacaatagaaacaaggaggaaagaaccatgtataaagcaattgtcgcagcaaaa
ggaaaaacaacaaaaattgttgaaaaagaatcgcgtccattgaaagataatgaagcgcgg
ttgaaaatggaagtctgtggtgtctgtcatacggatttacacgttaagaatgcagatttt
ggcgatgttagcggttgtaccttaggtcacgaaggaattgggattgtgacggaggttgga
aaagacgttactagtttaaagattggtgatcgtgcatctgttgcatggttttatgaaggc
tgcgggcattgcgaatattgtacttctggtcgagaaacgctttgtcgttcagtaaaaaat
gctggatatacagttgatggtgccatggccgaagaatgcatcgtcacagacggttatgca
gtgaaagtgccagaaaatttagcatcagagccagcttcctctattacttgtgcaggggta
acaacctacaaagcgataaaagaatctgggattcgtccaggtcaatggctaatgatttca
ggattaggtgggctaggtaatctagctttacaatatgccaagcatgtctttaatgcaaaa
gtagtagctgttgatgtgaatgataatcagttaacttttgcgaaagaaatgggtgctgat
cttttaattaatccagttaaagatcctgattttgctgcacaacttcaaaaagaaattggc
ggtgtccatgcagcagtagtcactgcggtagctaaatcagcatttaatggcgcagtcgat
gcagtccgtgcgggaggaacggttgtcgccgttggattgcctgttgagacaatggattta
tctattccacgtcttgttcttgatggcattcacgtagtcggatcgttagttggaacccgt
caagatttaagagaagctttccaattcggtgcagaaggaaaagttgttcctgtttgtcaa
acacgccaaccagaagaaattaatgctatttttgaagaaatggaacaaggaaaaattcgc
gggcgcatggtcattgattttcgcagttaa

DBGET integrated database retrieval system