KEGG   Enterococcus faecalis OG1RF: OG1RF_11586Help
Entry
OG1RF_11586       CDS       T01882                                 

Definition
transcriptional regulator (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
efi  Enterococcus faecalis OG1RF
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:efi00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    OG1RF_11586
Enzymes [BR:efi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     OG1RF_11586
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1650757..1652670
Genome map
AA seq 637 aa AA seqDB search
MMNIKDIAKLAGVSASTVSKIINNKDQTISKETRERVLKIVRDYNYTPYSANLVTNSTTK
TFVLLLNSHETFEAWVTSFIDKAQENGYNCLILNSHGSLEQELKNITSPTLKQASGIIWD
PINENSKQYAKFIEELTIPYYFVNHSTNELPSLAGLYEEASYVLTQELLQNNHKKISYFV
TNPKYKEAIIAGYKKALFDVNLPFSKENILTTIPADFSNQLITDGITGILTDDYTQAVFL
EQLLKQSGLRTPDNYSLLAIKRKIDRSFLPDHISSVLLDTETFGSQLALLLLNKRKEKTA
LINEAEKLVLDHKNTLGMSSVNPHSKMIVVGSLNVDNYLYSTNLPHNGKTNFLSSYAKFP
GGKGLNQAVGLTKLGHQATLIGCLGSDTDANYLYKELEKYHVTTDGVTRIQDAETGQAYI
YVETSGDSMISILPGANTALTPKKIAQQKHLFMDASFCLIQTEIPLSAVEKACEIAQHSG
VPIILKPAAIHHIPVNILEKVDFFIPNEDELLELQPDTGTLEEKAAYFLEMGVKNVIVTL
GKKGVLLKTPQVCHYFPATENIAVDSTGASDSFISALASYLSKGYPTEAAIQIAIQAAGF
SVSKEGVIDSLVDHVTLENYLIKKEPALFAHRNTCVD
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgatgaatattaaagatattgcaaaattagctggcgtttccgcttcaactgtatccaaa
attataaataataaagatcaaactattagtaaagaaacccgtgagcgtgtcttaaaaatc
gttcgagattacaactacacaccttactcagcaaatctcgtcacaaatagtactacaaaa
accttcgtgttattattaaatagccatgaaacttttgaggcttgggttacgagctttatt
gataaagctcaagaaaatggctataactgcttgattttaaatagtcacggtagtttagaa
caagaactgaaaaatattacctcgccaactttaaaacaagccagtggcattatttgggac
ccaatcaatgaaaacagtaaacaatacgcgaaatttatagaagaattaacgattccttac
tatttcgtcaatcactcaactaacgaattaccttctctagcggggctttatgaagaagct
agttatgttttaacccaagaattattacagaataaccataaaaaaattagttatttcgtc
actaacccaaaatataaagaagcaattattgcaggctataaaaaagccttgtttgatgtc
aatttaccctttagtaaagaaaatattttaactactatccctgctgatttcagtaatcag
cttatcacagatgggattacgggtatccttactgatgactatacccaggctgtttttttg
gaacagcttttaaagcagagcggtttgcgaacccccgataattactctttactcgcaatt
aagcgaaaaattgatcgttcatttttacctgatcatatttcttccgtcttattagataca
gagacgtttggcagccagttagccttattattgcttaacaaacgcaaagaaaaaacagcc
ttgattaatgaggctgaaaaattggtgctagatcacaaaaatacattaggcatgtctagt
gttaatccacatagcaaaatgattgtagtaggtagtttaaacgttgataattatctgtat
tcaacaaatttaccacataacggcaaaacaaattttttgtctagctatgctaaattcccc
ggcggaaaaggattaaatcaagctgttggcttaaccaaactggggcatcaggccacctta
attggttgtttaggctcagacacagatgcgaattacttatataaagaattagaaaaatac
cacgttacgacagatggtgtcacacgtattcaagatgctgagactggtcaagcttatatt
tatgttgagacaagcggcgactccatgatttcaatcttacctggtgcaaacacagcgctt
acacctaaaaaaatcgcacagcaaaaacacctatttatggatgccagtttttgtctcatt
caaacagaaattcctttgtctgctgtagagaaagcttgtgaaattgcccaacattcaggg
gtaccgattattttaaaaccagctgctattcatcatattccagtgaatatactagaaaag
gttgattttttcattcccaatgaagatgaattattggaacttcaaccagatactggtaca
ttagaagagaaagcggcgtacttcttagaaatgggcgtaaaaaatgtcattgttacttta
ggaaaaaaaggcgtgttattaaaaacaccccaagtgtgccactatttccctgcaacagaa
aatatagctgtggatagcactggtgccagtgacagctttatcagcgcgctcgcctcctat
ctttcgaaaggttatccgactgaagcagccattcaaatagcaattcaggctgcaggattt
tcagtttctaaagaaggggtgattgattctttagttgatcacgtcactttggaaaattat
ttgataaaaaaagaacccgctctttttgctcatcgtaacacctgtgtcgactga

  All links  
No link information was found.   
DBGET integrated database retrieval system