KEGG   Enterococcus faecalis OG1RF: OG1RF_11624Help
Entry
OG1RF_11624       CDS       T01882                                 

Gene name
tpiA
Definition
(RefSeq) triose-phosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
efi  Enterococcus faecalis OG1RF
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:efi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    OG1RF_11624 (tpiA)
   01230 Biosynthesis of amino acids
    OG1RF_11624 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OG1RF_11624 (tpiA)
   00051 Fructose and mannose metabolism
    OG1RF_11624 (tpiA)
   00562 Inositol phosphate metabolism
    OG1RF_11624 (tpiA)
Enzymes [BR:efi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     OG1RF_11624 (tpiA)
Exosome [BR:efi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   OG1RF_11624 (tpiA)
  Exosomal proteins of bladder cancer cells
   OG1RF_11624 (tpiA)
  Exosomal proteins of melanoma cells
   OG1RF_11624 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1693324..1694079)
Genome map
AA seq 251 aa AA seqDB search
MRKPIIAGNWKMNKTLSEAQSFAEAVKNAVPSNDVVDAVIGSPALFLAPLAWNLKDSEVK
LAAQNCYWENAGAFTGENSPAAIADLGVNYVIIGHSERREYFHETDEDINKKAKAIFANG
MTPIFCCGETLETYEAGKTAEWIEGQITNGLVGLSNEQVASMVIAYEPIWAIGTGKSADA
NIADEICGVVRSTVEKLYGKEVSEAVRIQYGGSVKPENIAEYMAKENVDGALVGGASLEA
DSFLALLDAVK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaaaccaattatcgctggtaactggaaaatgaacaaaactttaagcgaagcacaa
agctttgcagaagcagtaaaaaatgctgttccatcaaacgacgttgttgacgctgtgatt
ggatctccagcattattcttagctcctttagcttggaacctaaaagattctgaagtgaaa
ttagctgcacaaaactgctactgggaaaacgctggtgccttcactggtgaaaactcacca
gctgcaattgcagatttaggtgtaaactatgtgattatcggacactctgaacgtcgcgaa
tatttccacgaaacagatgaagatatcaataaaaaagccaaagcaatctttgcaaatggt
atgacaccaatcttctgttgtggtgaaactttagaaacgtatgaagctggtaaaacagcg
gaatggatcgaaggtcaaatcactaacggcttagttggtttatcaaacgaacaagttgct
tcaatggttatcgcttacgaaccaatctgggcaatcggaactggtaaatctgcagatgct
aatattgcagatgaaatctgtggtgttgttcgttcaacagttgaaaaattatacggcaaa
gaagtttctgaagctgttcgtattcaatacggtggttctgttaaaccagaaaacatcgct
gaatatatggcaaaagaaaacgttgacggtgctttagtcggcggcgcaagcttagaagca
gactcattcctagctttattagatgctgtaaaataa

DBGET integrated database retrieval system