KEGG   Enterococcus faecalis OG1RF: OG1RF_11852Help
Entry
OG1RF_11852       CDS       T01882                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
efi  Enterococcus faecalis OG1RF
Pathway
efi00260  Glycine, serine and threonine metabolism
efi00750  Vitamin B6 metabolism
efi01100  Metabolic pathways
efi01110  Biosynthesis of secondary metabolites
efi01120  Microbial metabolism in diverse environments
efi01230  Biosynthesis of amino acids
Module
efi_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:efi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    OG1RF_11852 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    OG1RF_11852 (thrC)
Enzymes [BR:efi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     OG1RF_11852 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP PK_C
Motif
Other DBs
NCBI-ProteinID: AEA94539
Position
complement(1952953..1954008)
Genome map
AA seq 351 aa AA seqDB search
MYEGLLKQYQAYLPVTEKTPMISLAEGNTPLIPLPNLSKELGIQLYGKYEGLNPTGSFKD
RGMVMAVAKAVEEGAKAIVCASTGNTSAAAAAYATRAGIKAYVVIPEGKIALGKLAQAIM
YGADIISIPGNFDEALKAVREIAKTEAVALVNSVNPYRLEGQKTAAFEVCEQLGQAPDVL
AIPVGNAGNISAYWKGFKEWHEKQGTTLPRMHGFEAEGAAAIVKGQVIEQPETVATAIRI
GNPASWQLAEQARDESGGFIDAVTDQEILTAYRKIAAQDGVFIEPGSAASLAGVIQHVKS
GKIKTGETVVAVFTGNGLKDPDTAMETEVAISKMSDVEEMRLHLRKGVATL
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgtatgaaggtttgttaaaacagtatcaagcgtatttgcccgtaacagaaaaaacacca
atgatttctttagccgaaggaaatacgccactgattcctttacctaatttatccaaagaa
ttaggtattcaattatatggaaaatacgaaggcttaaatcccactggctcattcaaagat
cgcgggatggtgatggctgtagcaaaagcggtagaagaaggtgccaaagcgattgtttgt
gcttctacaggaaatactagtgccgccgctgctgcgtatgccacaagagcaggcattaaa
gcgtatgtagtgattccagaaggaaaaatcgcactgggaaaattggcgcaagctattatg
tatggggcggacattatttcaattccaggtaactttgatgaagcattaaaagcggtgcga
gagattgcgaaaactgaggcagttgcgctagttaattcagtgaatccttatcgcttagaa
gggcaaaagacagcagcttttgaagtttgtgaacaattaggtcaagcgcccgatgtttta
gcgattccagttggaaatgccggcaatatttccgcttactggaaaggctttaaagaatgg
catgaaaaacaaggaacaactttaccaagaatgcatggttttgaagcagaaggtgccgca
gcgatcgtgaaaggccaagtgattgagcaacctgaaaccgtggcaacagcgatccggatt
ggaaatcctgctagttggcaattagcagaacaggcacgcgatgaatccggtggtttcatt
gatgccgtgacagatcaagaaattttaacggcttaccgaaaaattgctgctcaagatggg
gttttcattgaacctggttcggctgcttcattagctggagttattcaacatgttaaaagc
ggtaaaattaaaacaggtgaaaccgtcgtggcagtctttactggtaacggattgaaagat
cctgatacagcaatggagacagaagtagctatttcaaaaatgagtgacgtggaagaaatg
cgtctgcacttacgaaaaggagtcgcaacactatga

DBGET integrated database retrieval system