KEGG   Enterococcus faecalis OG1RF: OG1RF_11852Help
Entry
OG1RF_11852       CDS       T01882                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
efi  Enterococcus faecalis OG1RF
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:efi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    OG1RF_11852 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    OG1RF_11852 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    OG1RF_11852 (thrC)
Enzymes [BR:efi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     OG1RF_11852 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1952953..1954008)
Genome map
AA seq 351 aa AA seqDB search
MYEGLLKQYQAYLPVTEKTPMISLAEGNTPLIPLPNLSKELGIQLYGKYEGLNPTGSFKD
RGMVMAVAKAVEEGAKAIVCASTGNTSAAAAAYATRAGIKAYVVIPEGKIALGKLAQAIM
YGADIISIPGNFDEALKAVREIAKTEAVALVNSVNPYRLEGQKTAAFEVCEQLGQAPDVL
AIPVGNAGNISAYWKGFKEWHEKQGTTLPRMHGFEAEGAAAIVKGQVIEQPETVATAIRI
GNPASWQLAEQARDESGGFIDAVTDQEILTAYRKIAAQDGVFIEPGSAASLAGVIQHVKS
GKIKTGETVVAVFTGNGLKDPDTAMETEVAISKMSDVEEMRLHLRKGVATL
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgtatgaaggtttgttaaaacagtatcaagcgtatttgcccgtaacagaaaaaacacca
atgatttctttagccgaaggaaatacgccactgattcctttacctaatttatccaaagaa
ttaggtattcaattatatggaaaatacgaaggcttaaatcccactggctcattcaaagat
cgcgggatggtgatggctgtagcaaaagcggtagaagaaggtgccaaagcgattgtttgt
gcttctacaggaaatactagtgccgccgctgctgcgtatgccacaagagcaggcattaaa
gcgtatgtagtgattccagaaggaaaaatcgcactgggaaaattggcgcaagctattatg
tatggggcggacattatttcaattccaggtaactttgatgaagcattaaaagcggtgcga
gagattgcgaaaactgaggcagttgcgctagttaattcagtgaatccttatcgcttagaa
gggcaaaagacagcagcttttgaagtttgtgaacaattaggtcaagcgcccgatgtttta
gcgattccagttggaaatgccggcaatatttccgcttactggaaaggctttaaagaatgg
catgaaaaacaaggaacaactttaccaagaatgcatggttttgaagcagaaggtgccgca
gcgatcgtgaaaggccaagtgattgagcaacctgaaaccgtggcaacagcgatccggatt
ggaaatcctgctagttggcaattagcagaacaggcacgcgatgaatccggtggtttcatt
gatgccgtgacagatcaagaaattttaacggcttaccgaaaaattgctgctcaagatggg
gttttcattgaacctggttcggctgcttcattagctggagttattcaacatgttaaaagc
ggtaaaattaaaacaggtgaaaccgtcgtggcagtctttactggtaacggattgaaagat
cctgatacagcaatggagacagaagtagctatttcaaaaatgagtgacgtggaagaaatg
cgtctgcacttacgaaaaggagtcgcaacactatga

DBGET integrated database retrieval system