KEGG   Enterococcus faecalis OG1RF: OG1RF_11995Help
Entry
OG1RF_11995       CDS       T01882                                 

Gene name
est
Definition
lipase/esterase (EC:3.1.1.1)
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
efi  Enterococcus faecalis OG1RF
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2107343..2108005)
Genome map
AA seq 220 aa AA seqDB search
MLSRRLEKENYTVYSPNFSGHGTLVPEDILDQTTEQWWQDTQEAVAFLRERGYQEIAIFG
LSMGGIFSMHALTEQLTGLIGGGFFCSPIYPVENKVPENFVLYAENVMKIAEVPAEEQQS
RLQSIEQRVKQQLGAIETIASQTADKLNKIHAPLFLAQAGKDEMIEPMGVYQTAQALTQA
RVTLQWYPNSGHVITVSGEHKQLEQDVVQFLATLPWNEEK
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgttaagcagacgtttagaaaaagaaaattatactgtctattcgcctaatttttcagga
catggcacgctagttcctgaagatattttagatcaaacaacggaacaatggtggcaagat
acacaagaagcagtcgcttttttgagagaaagaggttaccaagaaattgccatttttggt
ttatcaatgggcgggattttcagtatgcatgcattaacggaacaattaacaggattaatt
ggtggtggatttttctgttcacctatctaccctgtcgaaaataaagtcccagaaaatttt
gtattatacgcagaaaacgtgatgaaaatcgcagaagttcctgcagaggaacaacaaagc
cggttgcaatcgattgagcaacgagtcaaacaacaattaggagcgattgaaacgattgct
agtcagacggctgacaaactaaacaaaatccacgcacctcttttcttagcgcaagctggc
aaagatgaaatgattgagccaatgggcgtctatcaaacggcccaagcgctaacacaagca
cgtgtgaccttacaatggtacccaaacagcggacatgtcattacggtgagtggagaacac
aaacaattagagcaagatgtggtgcaatttttagcaacactaccttggaatgaggagaaa
taa

DBGET integrated database retrieval system