KEGG   Enterococcus faecalis OG1RF: OG1RF_12244Help
Entry
OG1RF_12244       CDS       T01882                                 

Gene name
rbsK
Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
efi  Enterococcus faecalis OG1RF
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:efi00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    OG1RF_12244 (rbsK)
Enzymes [BR:efi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     OG1RF_12244 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2365947..2366864)
Genome map
AA seq 305 aa AA seqDB search
MKMNAVTIIGSINLDTTLRVKEMPKPGETIHAIEHFTAGGGKGANQAVAAKRSGAETYFI
GAVGNDGAGAMMTDLMSQDEINLTGVTTLEKTATGQAFIMVDNAGENSIMIYAGANNAFT
PKQVQEHQEIIEKSDFVIAQFESAIDSTIAAFKIAKKTGVKTILNPAPALEQVPEELLNV
TDMIVPNETETEILTGIKITDEASMRKAAEALHQLGIEAVIITVGSKGAFYDVNGRSGIV
PAFKVKAVDTTAAGDTFIGALSSILEKDFSNLEEAIRYGNKASSLTVQRFGAQPSIPYQH
ELADK
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgaacgcggttacaattatcggaagtatcaatttagacacaacattaagagtc
aaagaaatgccaaaaccaggcgaaacaattcacgccattgaacattttacagcgggtggt
ggtaaaggagcaaaccaagcagttgcagcgaaacgttcaggcgcagaaacatattttatt
ggtgctgtgggaaatgatggcgctggagctatgatgactgatttaatgagtcaagatgaa
attaatttaactggggtcaccactttagaaaaaacagctactggccaagcctttattatg
gtagataacgctggtgaaaatagcattatgatttacgcaggagccaataacgcctttacg
ccaaaacaagtacaggaacatcaagaaattattgaaaaaagtgattttgtgattgcccaa
tttgaaagtgcgattgatagtacgattgcagcgtttaaaattgctaaaaaaacaggcgtc
aaaacgattttaaatcccgcacctgcgttagaacaagttcctgaagaattactaaacgtg
acagatatgattgtaccaaatgaaacagaaaccgaaattttaacaggcattaaaatcaca
gatgaagcgagtatgcgtaaagccgcagaagcacttcatcaattagggattgaagcagta
attattacagtaggtagtaaaggcgccttttatgacgtcaatggacgaagtggtattgtg
cctgcttttaaagtgaaagcggttgatacaacggctgctggcgatacttttattggcgca
ttaagtagtatattagaaaaagattttagcaatttggaagaagctattcgttatggaaac
aaggcgtcctcgttgactgttcaacgttttggagcccaaccttcgattccttatcaacac
gaattggcagacaaataa

DBGET integrated database retrieval system