KEGG   Enterococcus faecalis OG1RF: OG1RF_12391Help
Entry
OG1RF_12391       CDS       T01882                                 

Gene name
gmk2
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
efi  Enterococcus faecalis OG1RF
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:efi00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    OG1RF_12391 (gmk2)
Enzymes [BR:efi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     OG1RF_12391 (gmk2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2530475..2531089)
Genome map
AA seq 204 aa AA seqDB search
MSERGLLIVLSGPSGVGKGTVRKAIFDSEENDFQYSISMTTRKQREGEVDGVDYYFRSRE
EFEAMIEAGEMLEYAEYVGNYYGTPLTYVNQTLDEGKDVFLEIEVQGAKQVKDKVPDGVF
IFLTPPDLAELKSRIIGRGTDEMSVIEERMAVAREEIEMMALYDYAVVNDEVPLAVQRIK
DIIASEHFRVDRVIGKYIKMLEEM
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgtcagagcgcgggttattaatcgtattgtcaggtccttcaggagtggggaaagggact
gtaagaaaggctattttcgacagtgaagaaaatgattttcaatattcaatctcaatgacc
actcggaaacagcgagaaggcgaagtggatggagtagattactatttccgttcaagagaa
gaatttgaagcgatgattgaagctggagaaatgttggaatatgcggaatatgttggtaac
tattatgggacaccattaacgtatgttaaccagacgctagatgaaggcaaagacgtcttt
ttagaaatcgaagtccaaggggctaaacaagtcaaagacaaagtgcctgatggcgtattt
atctttttgacaccccccgatttagcggaattaaaatcaagaattattggccgcggaaca
gacgaaatgtctgtgattgaagaacgaatggctgtggccagagaagaaatcgaaatgatg
gcgctgtatgattatgcggtagtgaatgatgaagttcctttagccgtgcaacgaattaaa
gacattatcgcgagtgagcacttccgtgttgaccgtgtaattggaaaatatattaaaatg
ttagaggagatgtag

DBGET integrated database retrieval system