KEGG   Enterococcus faecalis OG1RF: OG1RF_12446Help
Entry
OG1RF_12446       CDS       T01882                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
efi  Enterococcus faecalis OG1RF
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:efi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    OG1RF_12446 (dapE)
  Amino acid metabolism
   00300 Lysine biosynthesis
    OG1RF_12446 (dapE)
Enzymes [BR:efi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     OG1RF_12446 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2580515..2581741)
Genome map
AA seq 408 aa AA seqDB search
MFFTDLTKSVAVLLREAYTRIKHNKKGRMAMEKSEKISILQDVVKIKSVNGNEEEVAIYL
QNLLKKYEIPSELVSYAPNRSSLVAYLGENREKVLGFSGHMDVVSEGDESQWTFPPFAAH
IEGNKLYGRGATDMKSGLVAMVLAMIELKEKEVPLNGAVKFLGTVGEEVGELGAGQLTEK
GYADDLSALVIGEPTNYNLMYAHMGSINYSVVSHGKEAHSSMPEEGINAINNLNEFITEA
NQQMAEVTANYENPELGRTIHNVTVIKGGTQVNSIPGQAALQGNIRSIPEFSNDQVIALL
QKIVDELNKKEKHQLELTIDYNKIPVKAEKDSALIQAIQAQFDQPLPLVTSAGTTDLAEF
TKSDNTFDCVVFGPGVTTTAHQVDEYVEIDNYLDMIDKYQAIAKSYLN
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
gtgttttttactgacctaaccaagtcagttgcggttttactgagagaagcgtacactaga
attaagcataacaagaaagggcgaatggcaatggaaaaatcagaaaaaattagtatttta
caagatgtggttaaaattaaatctgtaaatggaaacgaagaagaagtggcaatctattta
caaaatcttttgaagaaatatgagatcccttctgaacttgtttcttatgcaccaaatcgt
agtagtttggttgcttatttaggtgaaaaccgagaaaaagtcttagggtttagtggccac
atggacgtggtttctgaaggggacgaaagtcaatggactttcccgccatttgcggcccat
attgaaggaaataaattgtatggccgtggcgcaacggacatgaaaagcggcttagtcgca
atggttttagcaatgattgaattaaaagaaaaggaagttccattaaatggagcggttaaa
tttttaggtacagttggtgaagaagttggtgagctaggtgctggccaattaactgaaaaa
ggctatgcggatgatttaagtgccttagtcattggagaaccaaccaattataacttgatg
tatgcgcacatgggttcaattaactattctgttgtgtcacacggaaaagaagcccacagt
tcgatgccagaagaaggcattaacgcgattaataatttgaacgaatttattacagaagca
aaccaacaaatggcggaagtcacagcaaactatgaaaatcctgaattaggtcgaacgatt
cacaatgtaaccgtcattaaaggtggcacacaagtgaacagtattccaggtcaagcagcc
ttgcaagggaatatccgttcaattccagaattcagcaacgaccaagtcattgcattatta
caaaaaattgtcgatgaattgaacaaaaaagaaaaacatcagttagaattaacgattgat
tacaataaaattcctgtaaaagctgagaaagattctgcgttaattcaagccattcaagcc
caatttgatcaaccattaccattagtgacaagcgctgggaccacagacttagctgaattt
actaaatcagacaatacatttgattgcgttgtctttggaccaggtgtgaccactactgca
caccaagtcgacgaatatgtcgaaattgataattatttagatatgattgataagtatcaa
gcgatagcaaaaagttatttaaattaa

DBGET integrated database retrieval system