KEGG   Enterococcus faecalis OG1RF: OG1RF_12514Help
Entry
OG1RF_12514       CDS       T01882                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
efi  Enterococcus faecalis OG1RF
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:efi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    OG1RF_12514 (folP)
Enzymes [BR:efi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     OG1RF_12514 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2662470..2663261)
Genome map
AA seq 263 aa AA seqDB search
MIDLKKNYQIMGIVNTTPDSFSDGGSYTTVDVAYQHALHLLEAGADILDIGGQSTRPGYE
EVSPQVEADRVLPLIKKIRETSLAPISVDTYYPEVAEAAIQAGATMINDIKGLDTPGMAE
VLAQYPEVQVVIMHSRKRQSLSLKEELHQFYTEKIEQFQKYGLSLEKICFDPGIGFHKTV
AENLQLLKDPNAFRYQDYPLLYGVSRKRTIGALTNEPEPANRDFGSAAASLYAAQQGVEI
LRVHNVQGLKQTFDVWRALSEKE
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgattgatttaaaaaagaattaccaaattatggggattgtcaacacgacccccgactct
ttttctgatggcggtagctacacaacggtcgacgtggcctatcaacatgcgcttcatcta
ctagaagcgggggccgatattttagacattggcggccaatccacacgtcctggctacgaa
gaagtttctccacaagttgaggcagaccgagtattaccgttaattaaaaaaatacgtgag
acttctctagcgccgatttctgtggatacctactatcccgaagtagcagaagccgcgatc
caagctggtgccacaatgattaatgacatcaaaggattagacactccggggatggcagaa
gtcctcgcacaatatcctgaagtccaagttgtgattatgcattctagaaaacgccaatcg
ctttctttaaaagaagagttgcaccaattttatacagaaaaaattgaacaattccaaaaa
tatgggctttccttagaaaaaatttgtttcgatccagggattggctttcataaaactgtc
gcagaaaaccttcaactgttaaaagatcctaacgcctttcgctaccaagattatccgtta
ctgtacggcgtttctcgcaaacgaactattggcgctttaacgaacgaaccagaaccagcc
aaccgtgattttggctcagccgctgcttccttgtatgcagcacaacaaggcgtagaaatt
ttacgtgttcataatgtccaaggcttaaaacaaacatttgatgtctggcgagcattgtcg
gagaaggagtaa

DBGET integrated database retrieval system