KEGG   Enterococcus faecalis OG1RF: OG1RF_12517Help
Entry
OG1RF_12517       CDS       T01882                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
efi  Enterococcus faecalis OG1RF
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:efi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    OG1RF_12517 (folK)
Enzymes [BR:efi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     OG1RF_12517 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2664414..2664899)
Genome map
AA seq 161 aa AA seqDB search
MIGYVALGSNVGDPYANLVKARNYLNEDPQIQVVASSKLYETDPYGYTDQDDFLNAVLKI
DTSYTAEELLAVTQGIEQAMKRKKLIHWGPRIIDIDILLLGEQSVALPHLQVPHQELTKR
SFVLIPLSDVYAEEQLLGAPIATWIQRSGNQEEVRVSEKEW
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgattggctatgtagcattaggtagtaacgtcggcgatccgtacgcaaatttagtgaaa
gcccgcaattatttaaacgaagacccgcagattcaggtcgtggcttcttcaaaactttat
gaaacggatccttacggctatacagaccaagatgattttttgaacgccgtattgaaaatt
gatactagctataccgctgaagagttattggctgttacccaagggattgagcaagcaatg
aaacgtaaaaaattaattcactggggtccgcggattattgatattgatattttattatta
ggggaacagtcagtcgcgttgccccacttacaagttcctcatcaagaattaacaaaacgg
tcatttgttttgattcccttaagtgatgtttacgcagaggaacaactattgggcgcgcca
atagctacgtggattcagcgcagtggcaatcaagaagaagtgcgagtaagcgaaaaggaa
tggtag

DBGET integrated database retrieval system