KEGG   Enterococcus faecalis 62: EF62_0318Help
Entry
EF62_0318         CDS       T01881                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
efl  Enterococcus faecalis 62
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:efl00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(347242..348033)
Genome map
AA seq 263 aa AA seqDB search
MIDLKKNYQIMGIVNTTPDSFSDGGSYTTVDVAYQHALHLLEAGADILDIGGQSTRPGYE
EVSPQVEADRVLPLIKKIRETSLAPISVDTYYPEVAEAAIQAGATMINDIKGLDTPGMAE
VLAQYPEVQVVIMHSRKHQSLSLKEELHQFYTEKIEQCQKYGLSLEKICFDPGIGFHKTV
AENLQLLKDPNAFRYQDYPLLYGVSRKRTIGALTNEPEPANRDFGSAAASLYAAQQGVEI
LRVHNVQGLKQTFDVWRALSEKE
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgattgatttaaaaaagaattaccaaattatggggattgtcaacacgacccccgactct
ttttctgatggcggtagctacacaacggtcgacgtggcctatcaacatgcgcttcatcta
ctagaagcgggggccgatattttagacattggcggccaatccacacgtcctggctacgaa
gaagtttctccacaagttgaggcagaccgagtattaccgttaattaaaaaaatacgtgag
acttctctagcgccgatttctgtggatacctactatcccgaagtagcagaagccgcgatc
caagctggtgccacaatgattaatgacatcaaaggattagacactccggggatggcagaa
gtcctcgcacaatatcctgaagtccaagttgtgattatgcattccagaaaacaccaatcc
ctttctttaaaagaagagttgcaccaattttatacagaaaaaattgaacaatgccaaaaa
tatgggctttccttagaaaaaatttgtttcgatccagggattggctttcataaaactgtc
gcagaaaaccttcaactgttaaaagatcctaacgcctttcgctaccaagattatccgtta
ctatacggcgtttctcgcaaacgaaccattggcgctttaacgaacgaaccagaaccagcc
aaccgtgattttggctcagccgctgcttccttgtatgcagcacaacaaggcgtagaaatt
ttacgtgttcataatgtccaaggcttaaaacaaacatttgatgtctggcgagcattgtcg
gagaaggagtaa

DBGET integrated database retrieval system