KEGG   Enterococcus faecalis 62: EF62_0321Help
Entry
EF62_0321         CDS       T01881                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
efl  Enterococcus faecalis 62
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:efl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    EF62_0321 (folK)
Enzymes [BR:efl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     EF62_0321 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(349186..349671)
Genome map
AA seq 161 aa AA seqDB search
MIGYVALGSNVGDPYANLVKARNYLNEDPQIQVVASSKLYETDPYGYTDQDDFLNAVLKI
DTSYTAEELLAVTQGIEQAMKRKKLIHWGPRIIDIDILLLGGQSVTLPHLQVPHQELTKR
SFVLIPLSDVYAEEQLLGAPIATWIQRSGNQEEVRVSEKEW
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgattggctatgtagcattaggtagtaacgtcggcgatccatacgcaaatttagtgaaa
gcccgcaattatttaaacgaagacccgcagattcaggtcgtggcttcttcaaaactttat
gaaacggatccttacggctatacagaccaagatgattttttgaacgccgtattgaaaatt
gatactagctataccgctgaagagttattggctgttacccaagggattgagcaagcaatg
aaacgtaaaaaattaattcactggggtccgcggattattgatattgatattttattatta
ggggggcagtcagtcacgttgccccacttacaagttcctcatcaagaattaacaaaacgg
tcatttgttttgattcccttaagtgatgtttacgcagaggaacaactattgggcgcgcca
atagctacgtggattcagcgcagtggcaatcaagaagaagtgcgagtaagcgaaaaggaa
tggtag

DBGET integrated database retrieval system