KEGG   Enterococcus faecalis 62: EF62_0451Help
Entry
EF62_0451         CDS       T01881                                 

Gene name
ruvA
Definition
Holliday junction ATP-dependent DNA helicase RuvA (EC:3.6.1.-)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
efl  Enterococcus faecalis 62
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:efl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    EF62_0451 (ruvA)
Enzymes [BR:efl01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     EF62_0451 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
493112..493726
Genome map
AA seq 204 aa AA seqDB search
MYEYIIGKVTFVSPYYIVVETNGIGYQISVDNPYRYSGKMDTDIKLYLHQVVREDAQLLF
GFGSLEEKQLFLKLISVSGIGPKSGLAIMASVADHGGLINAIEGEDVTYLTKFPGVGKKT
AQQMILDLKGKLGELESSEAAVAAMTVTEVVTTSNQALAEALEALSALGYSDREIKRITK
QLEALGETTTDVYLSNALKFMMKR
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgtacgaatatattattggaaaagtaacgtttgttagcccatactatattgtcgttgaa
acaaatggcattggctatcagatttcagtcgataacccgtatcgctattcaggaaaaatg
gatacggatattaaactatatcttcaccaagtcgtgcgggaagatgcacagctattattt
ggttttggcagtttagaagaaaaacaattgttcttaaaattaatcagtgtctctggaatt
ggccctaaaagtggtttagctatcatggcttctgtggctgatcatggtggtttaatcaat
gcaattgaaggggaagatgttacatatttaacgaagttcccaggtgttggcaagaaaaca
gcccaacaaatgattttagatttaaaaggaaaattaggggaattagagtcttccgaagca
gcggtggcggccatgaccgtaaccgaagtggtgacaacaagcaatcaagcattggcagaa
gcgttagaagcattaagtgccctaggctacagtgaccgagagattaagcgtatcactaag
caattggaagcgttaggtgagacaacgacagatgtctatttaagcaatgcgttaaaattc
atgatgaaacgctaa

DBGET integrated database retrieval system