KEGG   Enterococcus faecalis 62: EF62_0497Help
Entry
EF62_0497         CDS       T01881                                 

Gene name
endoE
Definition
glycosyl hydrolase family 20, catalytic domain protein
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
efl  Enterococcus faecalis 62
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:efl00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:efl00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
542341..544848
Genome map
AA seq 835 aa AA seqDB search
MNGVQKGMVFKVGNNLSTRKGENRETIVSWLGLSLLVGLAFILFSLFHQPMISQANEPTQ
EKHFMVYYRAWRDKTMQGVNTTLPDENWLTMHDIPYGIDIVNVFSYVPKGQEALAQPFYD
TLKNEYAPALHARGVRLVRGIDYSELLKVPYAGTTPTEAEFDAYAKELLTKFVDDLGIDG
LDIDMETRPSEKDIVLSNGVIRALSKYIGPKSGTDRPFLYDTNAEYLPPLQDVSDCFDFL
AYQQYGSDDQRTQRALNNLSPVLNGERFVPGLTFPEEQDRNRWYDTKEPYMESNMYKVAR
YSYENNLGGMFLYALDRDGRTYNEDDLNQIKPSNLLWTKTAIAESKGVSLAEMKAAAQHY
LKRISYANTDLEAQNKAAEAVTQATTLYDVNKAILGGDYGQGLSNTYDAELEKGLLAIDL
TTLYRALDQAVTAIEKAESYTPETIQALQTTKETVATELAGKTYTAAQVTTWQTEVQTAL
DNLKEKQTQPLKSVFSIDAGRKYFSVEQLEELVAKASQNGYTDVQLILGNDGLRFILDDM
SVNVNGKKYNHNRVSKAIQRGNNAYYNDPNGNALTQKEMDRLLAFAKARNINIIPVINSP
GHMDALLVAMEKLAIKNPAFDGSKRTVDLGNQKAVNFTKAIISKYVAYFSAHSEIFNFGG
DEYANDVDTGGWAKLQSSGRYKDFVAYANDLAKIIKDAGMQPMSFNDGIYYNSDDSFGTF
DPEIIISYWTAGWSGYDVAKPEYFVQKGHKIFNTNDAWYWVAGNVDSGIYQYDDALANMS
KKAFTDVPAGSPNLPIIGSIQCVWYDDPRRDYDFERIYTLMDTFSENYREYMVVK
NT seq 2508 nt NT seq  +upstreamnt  +downstreamnt
atgaacggagtgcagaaaggaatggtgttcaaagtggggaacaatttatcgacaagaaaa
ggagaaaacagagaaacaattgtcagttggctgggtctttcgttattggttggcttggcg
tttatcttatttagtctgtttcatcaaccaatgatcagccaagccaatgagccgacccaa
gagaaacattttatggtttattatcgggcttggcgtgacaaaacgatgcaaggagttaat
acaacattgccagatgaaaattggctaacgatgcacgatattccttatggtattgacatt
gtgaatgtctttagttatgtgccaaaaggacaagaagcacttgcacagccattttatgat
acgttaaaaaatgagtatgcgccagcactgcatgcacgaggtgttcgtttagttcgtggg
attgattacagcgagctattaaaagttccttacgcaggaacaacgcctacagaagcagaa
tttgatgcttatgcgaaagagttgttaaccaaatttgtcgatgatttaggaattgatggg
ttagatattgacatggaaactcgtccaagtgaaaaagatattgttctatctaatggtgtc
attcgtgcattatcaaaatacattggaccgaagtcgggaacggatcgtccatttttgtat
gataccaatgcagaatatttaccacctttacaagatgtcagtgactgtttcgattttctc
gcgtatcaacagtatggtagcgatgaccaacgcacgcaacgagcattaaataatttaagt
ccggttctcaatggggaacgatttgttccaggattaactttcccagaagagcaagatcgc
aaccgctggtatgacacaaaagagccgtatatggaaagtaacatgtataaagtagctcgt
tattcttatgaaaataatttagggggcatgttcctctatgccttagatcgcgatggtcgc
acctataatgaagacgatttaaatcagataaaaccttctaatttactttggacaaaaacg
gccattgcagagagtaaaggcgtttctcttgcagagatgaaagcggctgcgcaacactat
ttaaaacgaattagctacgccaacacagaccttgaagcacaaaataaagccgcagaagca
gtgacacaagcaacaacgctttatgatgtgaataaagctattttaggtggcgattatggc
caagggctttcaaacacctatgatgctgaattagaaaaaggcctgttagccattgactta
accactttatatcgtgcgttggatcaagcagttacagccattgaaaaggcagaaagttat
acaccagaaacgattcaagcactacaaacaacaaaagagacagtcgccacagaacttgcg
ggaaaaacgtatacagccgcacaagtgactacttggcaaacggaggtccaaacagctttg
gataatttaaaagagaaacaaacacaacctttaaaaagtgtcttttccattgatgcggga
agaaaatatttttccgtggagcaactggaagaattagtggccaaagctagtcaaaatggg
tacacagatgtccaattaattttaggaaatgatggcttacggtttatcttggatgatatg
tcggtcaatgtgaatggtaaaaaatacaaccacaaccgggtttcaaaagcaatccaacga
ggcaacaacgcatattacaatgatcctaatggcaacgcgttaacacaaaaagaaatggat
cggttgttggcttttgcgaaagcgcgcaacatcaacatcattcccgtgattaacagtcca
ggacatatggatgccttgttagtggccatggaaaaactagcgattaaaaatcccgctttt
gatggctcaaaacgaacagtagatttagggaaccaaaaggcagtgaatttcacaaaggcg
attatcagtaagtacgtggcttatttttccgcgcatagtgaaattttcaattttggcggc
gatgagtatgcaaatgatgtcgatacaggcggttgggcgaaactgcaatcttctgggcgc
tacaaagattttgtcgcttatgcgaatgatttagctaaaataattaaagatgcgggcatg
cagccaatgagcttcaatgatggcatttattacaacagcgacgattctttcggtacattt
gacccagagattattatttcttattggacagccggttggagcggatatgacgtagccaaa
cctgagtactttgttcaaaaaggacacaaaatttttaataccaatgatgcgtggtattgg
gtagctggcaatgttgattctggcatttatcaatatgatgatgctttagcaaatatgtcg
aaaaaagcatttacagatgtgccagcaggtagcccaaatcttccaattattggaagtatt
caatgtgtttggtatgatgaccctcgtcgtgactatgattttgaacgaatttatacgcta
atggatacgttctcggaaaattatcgtgagtatatggtggttaaataa

DBGET integrated database retrieval system