KEGG   Enterococcus faecalis 62: EF62_0660Help
Entry
EF62_0660         CDS       T01881                                 

Gene name
arbB1
Definition
6-phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
efl  Enterococcus faecalis 62
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:efl00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
678751..680181
Genome map
AA seq 476 aa AA seqDB search
MAFRKDFLWGGATAANQCEGGYNEGGRGLANVDLAPTGPDRFPVITGEKKMFNFDEEHFY
PAQEAIDMYHRYKEDIALFGEMGFKTYRLSIAWSRIFPMGDETEPNEEGLKFYEDLFKEC
HKYGIEPLVTITHFDCPMHLVEEYGAWRSRKLVGFYENLCRVIFNRYKGLVKYWLTFNEI
NMILHAPFMGAGLYFEEGENKEQVKYQAAHHELLASAIATKIAHEVDPENQVGCMLAAGS
NYAYTCKPEDVFAARQADRENYFFIDVQSRGEYPAYALKEMARKGIQIEMEEGDEELLKE
HTVDFISFSYYSSRVTSTDPEINEQTAGNIFASVKNPYLKASEWGWQIDPLGLRITMNDL
YDRYQKPLFIVENGLGAVDTPDENGYVVDDYRIDYLAAHIQAMKDAVEQDGVDLLGYTTW
GCIDLVSAGTGEMKKRYGFIYVDRDNEGNGTLKRSKKKSFDWYKKVIATNGEDLSN
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggcatttagaaaagactttttatggggtggcgcaacagcagccaatcaatgtgaaggt
ggctataacgaaggcggacgcggtttggcaaacgtcgatttagcgccaacgggtccagat
cgttttccagtaatcactggtgaaaagaaaatgtttaactttgatgaagaacatttctat
cctgcacaagaggcaattgatatgtatcatcgctataaagaagatatcgccttatttggt
gaaatgggttttaaaacataccgtttatccattgcttggagtcgaatttttccaatggga
gatgaaacagagccgaatgaagaaggcttgaagttctatgaagacttattcaaagaatgt
cataaatatgggattgagccactagtaacgattacacactttgactgcccaatgcactta
gtggaagaatatggcgcttggcgtagtcgtaagttagtaggtttctatgaaaatctttgt
cgtgtaattttcaaccgatataaaggattagtcaaatattggttaacatttaacgaaatt
aatatgattttacatgcaccatttatgggagcaggtctatactttgaagaaggcgaaaac
aaagaacaagtgaaataccaagcggcccatcatgaactactagcaagtgcaattgcgaca
aaaattgctcatgaggtagatcctgaaaaccaagtaggttgtatgttagcggctggttcc
aactacgcttatacttgtaaaccagaagatgttttcgctgctcgacaagcagatcgtgaa
aattatttctttattgatgtccaatcacgtggggaataccctgcgtatgctttaaaagaa
atggcccgtaaaggtattcaaattgaaatggaagaaggcgacgaagaacttttaaaagaa
catacggtggacttcatttcgttctcttattattcttctcgtgtcacatcaacagatcca
gaaattaatgaacaaacagctggtaacatctttgcctctgtgaaaaatccttatctaaaa
gccagtgaatggggttggcaaattgatccacttggtttgagaattacgatgaatgactta
tatgatcgttatcaaaaaccactattcattgttgaaaatggcttaggagcggtagataca
ccagacgaaaatggttatgtagtcgatgattatcgtatcgattatttggcggcgcatatt
caagcgatgaaagatgccgttgaacaagatggtgtcgacttgttaggctatacgacttgg
ggctgtattgatttagtatcagctggaacaggtgaaatgaaaaaacgctatggctttatc
tatgtggatcgcgataacgaaggaaatggtacgttaaaacgaagcaagaagaaatcgttt
gattggtacaaaaaagtaatcgcaacaaatggtgaagatttaagtaattaa

DBGET integrated database retrieval system