KEGG   Enterococcus faecalis 62: EF62_0956Help
Entry
EF62_0956         CDS       T01881                                 

Definition
(GenBank) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
efl  Enterococcus faecalis 62
Pathway
efl00010  Glycolysis / Gluconeogenesis
efl00260  Glycine, serine and threonine metabolism
efl00680  Methane metabolism
efl01100  Metabolic pathways
efl01110  Biosynthesis of secondary metabolites
efl01120  Microbial metabolism in diverse environments
efl01130  Biosynthesis of antibiotics
efl01200  Carbon metabolism
efl01230  Biosynthesis of amino acids
Module
efl_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
efl_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:efl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EF62_0956
  Energy metabolism
   00680 Methane metabolism
    EF62_0956
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EF62_0956
Enzymes [BR:efl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     EF62_0956
Membrane trafficking [BR:efl04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    EF62_0956
Exosome [BR:efl04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   EF62_0956
  Exosomal proteins of melanoma cells
   EF62_0956
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ADX79207
Position
947667..948335
Genome map
AA seq 222 aa AA seqDB search
MDVVLMRHGESEANFENYWTGWLDVSLTEKGQEQARKAGEKIKNAQIEFDAAFTSVLKRA
SLTCQIILEESDQLWIPTFKTWRLNERHYGALVGKNKDEMAREFGADQVKRWRRDYYEMP
PLVEENHFDRRYAQLADQDIPHGENLQMTVQRVAPLWQDEIAPLLGSGKNVLITGHGNSL
RALVKYLEDVPEDQMDTIDIPNAQPIHYRFDKNLQIVNKSIL
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggatgtagtactgatgcggcacggggaaagtgaagcaaattttgaaaattattggacg
ggatggctggatgtttctctgacagaaaaaggacaggaacaggctcgtaaggcaggggaa
aaaatcaaaaacgcgcagatcgagtttgacgctgcatttacgtcagtattgaagcgggca
tcattgacttgccagatcatcttagaagaaagcgatcagttatggataccgacatttaaa
acctggcgtctgaacgagcggcattatggcgctttagtagggaaaaataaggatgaaatg
gcacgagaattcggggcagatcaagtcaaacgctggcgtcgagattattatgaaatgcct
ccattagtagaagaaaaccattttgatcgccgttacgcacaattggcagatcaagacatt
cctcatggagaaaatctgcaaatgacggtccagcgggtcgcgccattatggcaagacgag
atcgcgccgctgttgggttcgggtaagaatgttttgattaccggacatggcaacagtctg
cgggcactggtgaaatatttggaggatgtaccggaagaccaaatggataccattgatatt
cccaatgcgcagccgatccactaccgctttgataagaacttgcagatcgtcaataaatcg
atcctctaa

DBGET integrated database retrieval system