KEGG   Enterococcus faecalis 62: EF62_0956Help
Entry
EF62_0956         CDS       T01881                                 

Definition
(RefSeq) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
efl  Enterococcus faecalis 62
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:efl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EF62_0956
   01230 Biosynthesis of amino acids
    EF62_0956
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EF62_0956
  Energy metabolism
   00680 Methane metabolism
    EF62_0956
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EF62_0956
Enzymes [BR:efl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     EF62_0956
Exosome [BR:efl04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   EF62_0956
  Exosomal proteins of melanoma cells
   EF62_0956
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
947667..948335
Genome map
AA seq 222 aa AA seqDB search
MDVVLMRHGESEANFENYWTGWLDVSLTEKGQEQARKAGEKIKNAQIEFDAAFTSVLKRA
SLTCQIILEESDQLWIPTFKTWRLNERHYGALVGKNKDEMAREFGADQVKRWRRDYYEMP
PLVEENHFDRRYAQLADQDIPHGENLQMTVQRVAPLWQDEIAPLLGSGKNVLITGHGNSL
RALVKYLEDVPEDQMDTIDIPNAQPIHYRFDKNLQIVNKSIL
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggatgtagtactgatgcggcacggggaaagtgaagcaaattttgaaaattattggacg
ggatggctggatgtttctctgacagaaaaaggacaggaacaggctcgtaaggcaggggaa
aaaatcaaaaacgcgcagatcgagtttgacgctgcatttacgtcagtattgaagcgggca
tcattgacttgccagatcatcttagaagaaagcgatcagttatggataccgacatttaaa
acctggcgtctgaacgagcggcattatggcgctttagtagggaaaaataaggatgaaatg
gcacgagaattcggggcagatcaagtcaaacgctggcgtcgagattattatgaaatgcct
ccattagtagaagaaaaccattttgatcgccgttacgcacaattggcagatcaagacatt
cctcatggagaaaatctgcaaatgacggtccagcgggtcgcgccattatggcaagacgag
atcgcgccgctgttgggttcgggtaagaatgttttgattaccggacatggcaacagtctg
cgggcactggtgaaatatttggaggatgtaccggaagaccaaatggataccattgatatt
cccaatgcgcagccgatccactaccgctttgataagaacttgcagatcgtcaataaatcg
atcctctaa

DBGET integrated database retrieval system