KEGG   Enterococcus faecalis 62: EF62_1273Help
Entry
EF62_1273         CDS       T01881                                 

Gene name
adhE
Definition
aldehyde-alcohol dehydrogenase 2 family protein (EC:1.2.1.10)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
efl  Enterococcus faecalis 62
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:efl00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    EF62_1273 (adhE)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EF62_1273 (adhE)
   00620 Pyruvate metabolism
    EF62_1273 (adhE)
   00650 Butanoate metabolism
    EF62_1273 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    EF62_1273 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    EF62_1273 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    EF62_1273 (adhE)
   00626 Naphthalene degradation
    EF62_1273 (adhE)
Enzymes [BR:efl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     EF62_1273 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     EF62_1273 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1262921..1265524
Genome map
AA seq 867 aa AA seqDB search
MNMVKTVKKEKTETVDVSSMIDELATKANVALKAMEDFTQEQVDHIVHQMAMAALDQHMP
LAKMAVEETGRGIYEDKAIKNMYASEYIWNNIKHDKTVGVINKDEQTGLMEIAEPVGVVC
GVTPTTNPTSTTIFKSLIALKTRNPIVFAFHPSAQKCSAEAARIVRDAAIAAGAPENCIQ
WIEQPSIDATSALMNHPGIAIVLATGGAGMVKSAYSTGKPALGVGPGNVPAYIEKTAKVK
RAVNDLIVSKSFDNGMICASEQAVIVDKEIYASVKAEFEAHNVYFVKPNELQKLEDAVMN
EGKYAVNPAIVGNSAEKIAELAGISVPKGTKILVAELEGAGPEYPLSREKLSPVLAMMKS
NNAEHAFELCEAMLNLGGLGHTAVIHTEDEELQVAFGLRMKACRILVNTPSAEGGIGNIY
NEMIPSLTLGCGSYGKNSVSKNVSAINLINIKTVAKRRNNMQWFKLPPKIFFEKNSLQYL
QKMENVERVMLVCDPGMVQFGYADIVRKELQKRKNDVKIEVFSDVEPNPSTNTVYAGTKM
MVDFQPDTVIALGGGSAMDAAKGMWMFYEHPDTEFFGAKQKFLDIRKRTYKIAKPEKTQF
VCIPTTSGTGSEVTPFAVITDSETHVKYPLADYALTPDVAIVDPQFVMSVPASVTADTGM
DVLTHAIESYVSVMASDYTRGLSLQAIKLVFDHLENSVKRPDMESREKMHNASTMAGMAF
ANAFLGICHSIAHKIGGEYGIPHGRTNAILLPHIIRYNAKDPSKHAMFPKYDYFRADTDY
ADIAKFLGLKGNTTAELVEALATAVADLGKSVGIDMNLKAQGVSQETLDTTVDRMAELAY
EDQCTTANPKEPLISELKQIILDAYVG
NT seq 2604 nt NT seq  +upstreamnt  +downstreamnt
atgaacatggttaaaacagtaaaaaaagaaaagacagaaacagttgatgtttcatcaatg
attgatgaattagcaacaaaagcgaatgtcgctttaaaagcaatggaagattttacacaa
gaacaagtagatcacattgtccatcaaatggcgatggcggctttagaccaacatatgcct
ttagcaaaaatggctgtcgaagaaactggccgtggaatctatgaagataaagcaatcaaa
aatatgtatgcatctgaatacatttggaataatattaaacatgataaaactgtgggtgta
attaacaaagacgaacaaaccggtttaatggaaattgctgagccagttggcgtggtatgt
ggggtcacaccaacaacaaacccaacgtcaacaactatttttaaatcactaatcgcctta
aaaacaagaaatccaattgtttttgctttccatcctagcgcacaaaaatgttcggcagaa
gcggcacgtattgtacgggatgcggcgattgcagcaggtgcaccagaaaattgtattcaa
tggattgaacaaccatcgattgatgcaacatctgctttgatgaatcatccagggattgcc
attgttttagcaactggtggcgcaggcatggtaaaatctgcgtactcaacaggtaaacca
gcactaggcgttggtcctgggaacgtaccagcttatattgaaaaaacggctaaagtaaaa
cgtgcggttaatgatttaattgtttcaaaatcatttgataatggaatgatttgtgcttct
gagcaagcggtcattgtggataaagaaatttatgcttctgtcaaagctgagtttgaagca
cacaatgtttacttcgtgaaaccgaatgaattacaaaaactagaagatgcagtgatgaat
gaaggcaaatacgcagtaaatccagcgattgtcggtaactctgcagaaaaaattgctgaa
ttagcaggaattagcgtaccaaaaggcacaaaaattttagtcgctgaattagaaggtgca
ggtccagaatatccattatcaagagaaaaattatcgccagttttagcaatgatgaaatca
aacaatgcagagcatgcttttgaactatgtgaagcgatgttaaacttaggtggtttagga
catacagcagtaattcatacagaagatgaagagttacaagttgcttttggtttacgtatg
aaagcttgtcgtattttagtgaatactccatcagcagaaggcggtatcggtaacatttat
aacgaaatgattccatctttaacacttggttgtggttcatacgggaaaaactctgtttct
aaaaacgtatcagccattaacttaattaatattaaaacggtagcgaaacggagaaataat
atgcaatggtttaaattacctccaaaaattttctttgaaaaaaattctttacaatatcta
caaaaaatggaaaatgttgaacgtgtcatgttagtttgtgacccaggtatggttcaattt
ggctatgcagatatcgtacgtaaagagctacaaaaacgtaaaaatgatgtgaaaatcgaa
gtattttctgatgttgaaccaaacccatcaacaaatactgtttatgcaggtaccaaaatg
atggttgatttccaaccagatacagtgattgccttgggtggcggttctgcaatggacgcg
gcgaaaggcatgtggatgttctatgaacacccagatacagagttctttggtgcaaaacaa
aaattcttagatatccgcaaacggacatataaaattgccaaaccagaaaaaacacaattt
gtttgtatcccaactacttcaggaactggttcagaagttacaccatttgccgttattact
gatagtgaaacacacgtgaaatatccgttagcagactatgcattaacaccagatgtagcg
attgttgatccacagttcgtaatgtctgtgccagcttcagtcactgcagatacaggtatg
gatgttttaacacatgctattgaatcttatgtttccgtgatggcttcagattacacacgt
ggtttaagtttacaagcaatcaagttagttttcgatcatttagaaaattcagtgaaacgt
ccagatatggaatctcgcgaaaaaatgcataatgcatcaaccatggcagggatggcattt
gccaatgcattcttaggtatttgtcactctattgctcataaaattggtggggaatatggc
attccacatggtcgtacaaatgcgattttattaccacatattattcgttacaatgcgaaa
gatccatcaaaacacgcaatgttccctaaatatgattacttccgcgccgatactgattat
gcagacattgcaaaattcttaggcttaaaaggaaatactaccgcagaattagtagaagct
ttagcaacagcagtagcagacttaggtaaatcagtcggaattgacatgaacttgaaagcc
caaggtgtctcacaagaaacattagacacaacggttgatcgtatggcagaacttgcatat
gaagaccaatgtacaactgcaaatccgaaagaaccattaattagtgaactaaaacaaatt
atcttagatgcttatgtaggataa

DBGET integrated database retrieval system