KEGG   Enterococcus faecalis 62: EF62_1483Help
Entry
EF62_1483         CDS       T01881                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
efl  Enterococcus faecalis 62
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:efl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EF62_1483 (pfkA)
   01230 Biosynthesis of amino acids
    EF62_1483 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EF62_1483 (pfkA)
   00030 Pentose phosphate pathway
    EF62_1483 (pfkA)
   00051 Fructose and mannose metabolism
    EF62_1483 (pfkA)
   00052 Galactose metabolism
    EF62_1483 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    EF62_1483 (pfkA)
Enzymes [BR:efl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     EF62_1483 (pfkA)
Protein phosphatases and associated proteins [BR:efl01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     EF62_1483 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1446485..1447447
Genome map
AA seq 320 aa AA seqDB search
MKRIGILTSGGDAPGMNAAIRAVVRKSIFDGIEVYGINYGFAGLVAGDIRRLDVADVGDK
IQRGGTFLYSARYPEFATEEGQLKGIEQLKKFGIEGLVVIGGDGSYHGAMALTKRGFPAV
GIPGTIDNDIPGTDFTIGFDTAINTVLESIDRIRDTATSHVRTFVIEVMGRNAGDIALWS
GVAGGADEIIIPEHDFDMKNVAKRIQEGRDRGKKHCLIILAEGVMGGNEFADKLSEYGDF
HTRVSILGHVVRGGSPSARDRVLASKFGSYAVELLKEGKGGLCIGMLDNQVVAADIIDTL
ENNKHKPDLSLYELNHEISF
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcattggtattttaaccagcgggggagatgcccctggaatgaacgctgcaatt
cgtgcagtcgtacgcaaaagtatttttgatggaatcgaagtttacggtattaactatgga
tttgccggtttagtcgcaggcgacatccgtcgtttagatgttgctgacgttggcgataag
attcaacgtggtggaacattcttgtactctgctcgttatcctgaatttgctactgaagaa
gggcaattaaaaggaatcgaacaattgaaaaaattcggtattgaaggcttagttgttatt
ggtggagacggttcttatcatggcgcaatggctttgacaaaacgtggtttccccgctgtt
ggaattcctggaacaattgataatgatattcctggaacagatttcacaatcggttttgat
acagcgattaacactgttttggaatcaattgaccgaattcgtgatacagcaacttctcat
gttcgtacattcgttatcgaagtaatgggacgtaacgctggtgatatcgcattgtggtca
ggcgtggcaggcggagcagatgaaatcattattcctgaacatgattttgatatgaaaaac
gttgccaaacgtattcaagaaggccgcgaccgcgggaaaaaacattgcttaatcatttta
gcagaaggcgtaatgggtggaaatgaatttgctgataaactttctgaatacggtgatttc
catacgcgtgtatcaattttaggacacgtggttcgtgggggctcgccaagtgctcgtgac
cgtgtattagcaagtaaatttgggtcatatgctgttgaacttctaaaagaaggcaaaggc
ggtttatgtatcggtatgttagataaccaagtagttgcagctgatattattgatacgtta
gaaaacaataaacacaaaccagatttatctctttatgagttaaatcatgaaatttctttt
taa

DBGET integrated database retrieval system