KEGG   Enterococcus faecalis 62: EF62_1483Help
Entry
EF62_1483         CDS       T01881                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
efl  Enterococcus faecalis 62
Pathway
efl00010  Glycolysis / Gluconeogenesis
efl00030  Pentose phosphate pathway
efl00051  Fructose and mannose metabolism
efl00052  Galactose metabolism
efl00680  Methane metabolism
efl01100  Metabolic pathways
efl01110  Biosynthesis of secondary metabolites
efl01120  Microbial metabolism in diverse environments
efl01130  Biosynthesis of antibiotics
efl01200  Carbon metabolism
efl01230  Biosynthesis of amino acids
efl03018  RNA degradation
Module
efl_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:efl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EF62_1483 (pfkA)
   00030 Pentose phosphate pathway
    EF62_1483 (pfkA)
   00051 Fructose and mannose metabolism
    EF62_1483 (pfkA)
   00052 Galactose metabolism
    EF62_1483 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    EF62_1483 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    EF62_1483 (pfkA)
Enzymes [BR:efl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     EF62_1483 (pfkA)
Protein phosphatases and associated proteins [BR:efl01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     EF62_1483 (pfkA)
Messenger RNA biogenesis [BR:efl03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     EF62_1483 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: ADX79726
Position
1446485..1447447
Genome map
AA seq 320 aa AA seqDB search
MKRIGILTSGGDAPGMNAAIRAVVRKSIFDGIEVYGINYGFAGLVAGDIRRLDVADVGDK
IQRGGTFLYSARYPEFATEEGQLKGIEQLKKFGIEGLVVIGGDGSYHGAMALTKRGFPAV
GIPGTIDNDIPGTDFTIGFDTAINTVLESIDRIRDTATSHVRTFVIEVMGRNAGDIALWS
GVAGGADEIIIPEHDFDMKNVAKRIQEGRDRGKKHCLIILAEGVMGGNEFADKLSEYGDF
HTRVSILGHVVRGGSPSARDRVLASKFGSYAVELLKEGKGGLCIGMLDNQVVAADIIDTL
ENNKHKPDLSLYELNHEISF
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcattggtattttaaccagcgggggagatgcccctggaatgaacgctgcaatt
cgtgcagtcgtacgcaaaagtatttttgatggaatcgaagtttacggtattaactatgga
tttgccggtttagtcgcaggcgacatccgtcgtttagatgttgctgacgttggcgataag
attcaacgtggtggaacattcttgtactctgctcgttatcctgaatttgctactgaagaa
gggcaattaaaaggaatcgaacaattgaaaaaattcggtattgaaggcttagttgttatt
ggtggagacggttcttatcatggcgcaatggctttgacaaaacgtggtttccccgctgtt
ggaattcctggaacaattgataatgatattcctggaacagatttcacaatcggttttgat
acagcgattaacactgttttggaatcaattgaccgaattcgtgatacagcaacttctcat
gttcgtacattcgttatcgaagtaatgggacgtaacgctggtgatatcgcattgtggtca
ggcgtggcaggcggagcagatgaaatcattattcctgaacatgattttgatatgaaaaac
gttgccaaacgtattcaagaaggccgcgaccgcgggaaaaaacattgcttaatcatttta
gcagaaggcgtaatgggtggaaatgaatttgctgataaactttctgaatacggtgatttc
catacgcgtgtatcaattttaggacacgtggttcgtgggggctcgccaagtgctcgtgac
cgtgtattagcaagtaaatttgggtcatatgctgttgaacttctaaaagaaggcaaaggc
ggtttatgtatcggtatgttagataaccaagtagttgcagctgatattattgatacgtta
gaaaacaataaacacaaaccagatttatctctttatgagttaaatcatgaaatttctttt
taa

DBGET integrated database retrieval system