KEGG   Enterococcus faecalis 62: EF62_1806Help
Entry
EF62_1806         CDS       T01881                                 

Gene name
pdh
Definition
pyruvatedehydrogenase complex, dihydrolipoyllysine-residue acetyltransferase component (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
efl  Enterococcus faecalis 62
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:efl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EF62_1806 (pdh)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EF62_1806 (pdh)
   00020 Citrate cycle (TCA cycle)
    EF62_1806 (pdh)
   00620 Pyruvate metabolism
    EF62_1806 (pdh)
Enzymes [BR:efl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     EF62_1806 (pdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1775099..1776718
Genome map
AA seq 539 aa AA seqDB search
MAYQFKLPDIGEGIAEGEIVKWFVKPGDTINEDDTLLEVQNDKSVEEIPSPVTGTVKNIV
VPEGTVANVGDVLIEIDAPGHEDNDAAPAAPAQEQTPAQPAAVPTTEAAGGFFQFKLPDI
GEGIAEGEIVKWFVKAGDTINEDDSLLEVQNDKSVEEIPSPVTGTVKNIVVPEGTVANVG
DVLVEIDAPGHNSAAPAAAAPATDAPKAEASAPAASTGVVAAADPNKRVLAMPSVRQYAR
EKNVNITQVTATGKGGRVIKADIDAFVSGGSQAAPATEAAATEAAPKAEAAAPKAAPKAF
TSDLGEMETREKMTPTRKAIAKAMVNSKHTAPHVTLHDEVEVSKLWDHRKKFKDVAAANG
TKLTFLPYVVKALTSTVQKFPILNASIDDAAQEIVYKNYFNIGIATDTDHGLYVPNVKNA
NTKSMFAIADEINEKAALAIEGKLTAQDMRDGTITISNIGSVGGGWFTPVINYPEVAILG
VGTIAQEPVVNADGEIVVGRMMKLSLSFDHRIVDGATAQKAMNNIKRLLADPELLLMEG
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atggcttatcagtttaaattaccggatatcggtgaagggattgccgaaggcgaaatcgtt
aaatggtttgtaaaacctggcgatacaatcaacgaagacgatacgttattagaagtacaa
aatgacaaatcagtggaagaaattccatcaccagtaacaggtactgtaaaaaatatcgtt
gtaccagaaggaacagttgcaaacgttggtgacgtgttaatcgaaatcgacgcacctggt
cacgaagataacgatgcagcaccagcagctcctgcacaagaacaaacaccagcacaacct
gctgctgtaccaacaaccgaagcagctggcggatttttccaattcaaattaccagacatc
ggtgaaggaattgccgaaggcgaaatcgttaaatggttcgttaaagcgggcgacacaatt
aatgaagatgattcattattagaagtacaaaatgacaaatcagtagaagaaattccatca
ccagtaacaggtactgtaaaaaatatcgttgtaccagaaggaacagttgccaatgtgggt
gacgtgttagttgaaattgacgcacctggtcataattcagcagcaccggcagccgcagca
ccagctactgacgctcctaaagcggaagcatcagctccagccgcttcaacaggcgtagtt
gcagccgctgatccaaacaaacgcgttttagcaatgccatctgttcgtcagtatgcacgt
gaaaaaaacgttaatattacacaagtaactgcaactggtaaaggtggccgtgtcattaaa
gcggatattgatgcctttgtctctggtggttctcaagcagcaccagctactgaagctgcc
gcaacagaagcagcacctaaagcggaagccgctgcacctaaagcagcgccaaaagccttt
acttctgatttaggcgaaatggaaacacgtgaaaaaatgacaccaacacgtaaagcaatt
gctaaagcaatggttaacagcaaacacactgctcctcacgtaacattacatgatgaagta
gaagtttctaaattatgggatcaccgtaagaaatttaaagatgttgctgctgcaaatggt
acaaaattaacattcttaccatacgttgtaaaagcattgacttcaactgttcaaaaattc
ccaatcttgaatgcatcaatcgatgatgcagcacaagaaattgtttacaaaaattacttt
aacattggtatcgctactgatacagatcatggcttatatgtaccaaatgttaaaaatgct
aatacgaagagcatgtttgctatcgctgatgaaatcaacgaaaaagcagcattggctatc
gaaggcaaattaactgcacaagatatgcgtgatggtacaatcacaattagtaacattggt
tcagtcggtggcggctggtttacaccagtaatcaactaccctgaagttgctattttaggc
gttggtacaattgcacaagaaccagttgttaatgcagacggcgaaatcgttgtgggacgc
atgatgaaattatcattaagctttgaccaccgtatcgttgacggcgcaactgctcaaaaa
gcaatgaacaacattaaacgcttattagctgatccagaattactattaatggaaggatga

DBGET integrated database retrieval system