KEGG   Enterococcus faecalis 62: EF62_1883Help
Entry
EF62_1883         CDS       T01881                                 

Gene name
fbp
Definition
(GenBank) fructose-1,6-bisphosphatase
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
efl  Enterococcus faecalis 62
Pathway
efl00010  Glycolysis / Gluconeogenesis
efl00030  Pentose phosphate pathway
efl00051  Fructose and mannose metabolism
efl00680  Methane metabolism
efl01100  Metabolic pathways
efl01110  Biosynthesis of secondary metabolites
efl01120  Microbial metabolism in diverse environments
efl01130  Biosynthesis of antibiotics
efl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:efl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EF62_1883 (fbp)
   00030 Pentose phosphate pathway
    EF62_1883 (fbp)
   00051 Fructose and mannose metabolism
    EF62_1883 (fbp)
  Energy metabolism
   00680 Methane metabolism
    EF62_1883 (fbp)
Enzymes [BR:efl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     EF62_1883 (fbp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2
Motif
Other DBs
NCBI-ProteinID: ADX80105
Position
complement(1856989..1858869)
Genome map
AA seq 626 aa AA seqDB search
MATLNRDQQIEEIINLEAILNLPKGTEHFVSDLHGEFEAFDHILRNGSGRIREKVQFLFK
QELNAHQMDELCFIIYYPEEKLTLLENESALSYEWWLLTIRRLVEIVRSSSMKYTRSKVR
KALPETYGYILEELIYQYDETTTKNGYYQQIIEKIILLGEAKRFVTELAYLIQRLIIDHL
HVIGDIYDRGPAPDKIMDRLMSYHSLDIQLGNHDMIWLAAYSGSLACLANVVRICARYGN
LDLLEERYAIDLTALKKFSLETYKENPAFAPKKNPYRALTEDEKQVAMRVQQAIAIIQEK
LEGQIIGRRPDFNLAHRLRLDKIQGETITFDECRYTLINSCFQTVSEEQPYQLTREEKQI
IDDLLTQFQSSPRLTKHMRFLMEKASLYLVYNQNLLIHGCLPLNADGTFQAYTFKGHSYS
GKALVDFFQEMLEEAYAQPASTDDYATDCLWYLWCGEGSSLFGKRAMKTFERYFLAEKET
HYEEKNPYYSLRDTVEVCERILDEFEVTGENRHIINGHTPVKRTKGESPIKANGTLLVID
GGFSKSYQTITGIAGYTLLYNSFGLQLTAHKSFSSKETAILNNQDIHSIKQVIDRPLQRL
LVKDTTIGKELLKQSQALQKQMKQNQ
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
ttggctacactgaaccgcgatcaacaaattgaagaaattattaatttggaagcaattttg
aatttaccgaaaggaacagaacattttgtcagtgatttacatggtgaatttgaagctttt
gaccatattttaagaaatggttctgggcgaatccgagaaaaagttcaatttttatttaaa
caagaattaaatgcccatcagatggacgagctttgttttattatctactatccagaagaa
aaattaacacttttagaaaatgaaagcgccctctcttatgaatggtggctattaacgatt
cgccgtctggttgaaatcgtccgttcttcttcgatgaagtacacacgttctaaagttcgc
aaagcccttcctgaaacctatgggtatattctcgaagaattgatttatcaatatgatgaa
acaacaaccaaaaacggttactatcaacaaattattgaaaaaattattttactaggtgaa
gccaaacgtttcgtgacagaattagcttatctaatccaacgtctgattatcgatcaccta
catgttattggggatatctatgaccgggggccagcaccagataaaattatggaccgatta
atgtcctatcactccttggatattcaactaggcaatcatgatatgatttggctggctgct
tatagtggttcactggcttgtttagccaatgtagtacgtatttgtgctcgctatggaaat
ttagatttgttagaagaacgttatgctatcgatttaaccgccttaaaaaaatttagttta
gaaacgtataaagaaaatcctgcttttgcacccaagaaaaatccctatcgtgcgttaact
gaagatgaaaaacaagtagcgatgcgtgtgcaacaagccattgccattattcaagaaaaa
ctagaaggccaaattattggtcgacgccctgattttaacttggcacatcggctacgccta
gataagattcaaggggaaactattacttttgacgaatgtcgttatacattaattaacagc
tgtttccaaaccgtttctgaagagcagccttaccaattaacacgtgaggaaaaacagata
attgatgatttattaacgcaatttcagtcttcaccgcggttaacaaaacacatgcgcttt
ctaatggaaaaagcctctctttaccttgtgtataatcaaaatttattgatccacggctgt
ctgcctctgaatgcggacggtacttttcaagcttatacatttaaaggccactcctattca
ggaaaagctttagttgacttctttcaggaaatgttagaagaagcttatgctcagcctgct
agcacagatgactatgcaacagattgtttatggtatctttggtgtggcgaaggttcctca
ttatttggtaaacgagctatgaaaacctttgagcgttattttctcgctgaaaaagaaaca
cattacgaagaaaagaatccttattactctttgcgtgatacggttgaagtttgtgaaaga
atcctagatgaatttgaagtgactggtgaaaatcgacatatcattaatggccatacacca
gttaaacgaacaaaaggcgaatcgccaatcaaagcaaatggcacgcttctcgtaattgac
ggcggcttttcaaaatcttatcagacaattactgggattgctggttatacattgttgtac
aactcgtttggtttacaactgaccgcgcataaatctttttctagtaaagaaacagccatt
ttaaataatcaagacattcattccatcaaacaagtcatcgatcgccccttacagcggtta
ttggtgaaagataccactatcggcaaagagctattaaagcaatcgcaagcactccaaaaa
caaatgaaacaaaaccagtag

DBGET integrated database retrieval system