KEGG   Enterococcus faecalis 62: EF62_1957Help
Entry
EF62_1957         CDS       T01881                                 

Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
efl  Enterococcus faecalis 62
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:efl00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:efl00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1934489..1934983
Genome map
AA seq 164 aa AA seqDB search
MLAAIWAQDEQGVIGKEGKLPWHLPNDLKFFKEKTIHNTLVLGRATFEGMGCRPLPNRTT
IVLTSNPDYQAEGVLVMHSVEEILAYADKYEGVTVIGGGSVVFKELIPACDVLYRTMIHE
TFEGDTFFPEIDWSVWEKVATVPGIVDEKNLYAHDYETYHRNDK
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgttagcagccatttgggcccaagatgaacaaggagtgattggtaaagaaggcaaattg
ccttggcatttacccaacgacttgaaatttttcaaggaaaaaacaattcataatacattg
gtcttaggacgtgcaactttcgaaggcatgggatgtcgtccgttaccaaatcgaacaacg
attgttcttaccagtaatccggattaccaagctgaaggcgttttggttatgcattccgta
gaggaaattcttgcgtatgctgacaagtatgaaggcgtgaccgttattggtggaggttct
gtcgtttttaaagaactgattcccgcatgcgatgtcttatatcggacgatgattcatgaa
acatttgaaggcgacaccttctttccagaaatcgactggtctgtttgggaaaaagttgcc
actgttcccggcatcgtggacgagaaaaatctctatgcacatgactatgaaacgtatcat
cgaaacgataaataa

DBGET integrated database retrieval system