KEGG   Enterococcus faecalis 62: EF62_1957Help
Entry
EF62_1957         CDS       T01881                                 

Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
efl  Enterococcus faecalis 62
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:efl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    EF62_1957
   00670 One carbon pool by folate
    EF62_1957
Enzymes [BR:efl01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     EF62_1957
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1934489..1934983
Genome map
AA seq 164 aa AA seqDB search
MLAAIWAQDEQGVIGKEGKLPWHLPNDLKFFKEKTIHNTLVLGRATFEGMGCRPLPNRTT
IVLTSNPDYQAEGVLVMHSVEEILAYADKYEGVTVIGGGSVVFKELIPACDVLYRTMIHE
TFEGDTFFPEIDWSVWEKVATVPGIVDEKNLYAHDYETYHRNDK
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgttagcagccatttgggcccaagatgaacaaggagtgattggtaaagaaggcaaattg
ccttggcatttacccaacgacttgaaatttttcaaggaaaaaacaattcataatacattg
gtcttaggacgtgcaactttcgaaggcatgggatgtcgtccgttaccaaatcgaacaacg
attgttcttaccagtaatccggattaccaagctgaaggcgttttggttatgcattccgta
gaggaaattcttgcgtatgctgacaagtatgaaggcgtgaccgttattggtggaggttct
gtcgtttttaaagaactgattcccgcatgcgatgtcttatatcggacgatgattcatgaa
acatttgaaggcgacaccttctttccagaaatcgactggtctgtttgggaaaaagttgcc
actgttcccggcatcgtggacgagaaaaatctctatgcacatgactatgaaacgtatcat
cgaaacgataaataa

DBGET integrated database retrieval system