KEGG   Enterococcus faecalis 62: EF62_1982Help
Entry
EF62_1982         CDS       T01881                                 

Definition
beta-glucosidase (EC:3.2.1.21)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
efl  Enterococcus faecalis 62
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:efl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EF62_1982
Enzymes [BR:efl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     EF62_1982
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1964163..1965572)
Genome map
AA seq 469 aa AA seqDB search
MVKQFKNDFLWGASSSAFQIEGAWNEDGKGLTVADYNSFKKSAVQADTKVASDFYHRFKE
DIALMKELGLKTYRFSLSWARIIPTGDGEINQAGIDFYNAVIDTLLENDILPFVTLYHFD
LPFALVEKYNGWADRRCVSAFQRYAQVCYQAFGDRVKNWQVTNEQNLMIRVDERMNMYDV
APENVEKIRAQMDYHMFVAHALATNDCHQLVAGGKVGPSVSSTMTYPSSNKPEDVWAARM
NDNFKTNYALEMYCLGEYPGYYQEYLTKCGIYPETQPEDQAILKAAKPDFIALNYYRTLV
ASYLPTDEQHPLGTKEKDIDFDLYGYFKIEKNQHLKTSKYGAQIDPTGLRLVLNDYYRQY
RLPLIITENGLGTPDRLTEDGKVHDDYRIAYLHDHIAACHAAISDGVELFSYCPWSVMDI
LSSHQGFKKRYGFIYVNREDHELKDLRRIKKDSFYWYQSVIKNNGLPEE
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggttaaacaatttaagaacgattttttatggggcgcttcttcctccgcttttcaaatt
gagggcgcttggaatgaggacggcaaaggcctaacagtcgctgattacaattcttttaaa
aagtcagctgtacaagcagatacgaaagtcgccagcgatttttaccatcgtttcaaagag
gacattgcgttaatgaaagaattaggcttaaaaacctatcgtttttctctttcatgggca
cgaatcattccaacaggtgatggcgaaatcaatcaagccggcatcgatttttataatgct
gtcattgatacacttttagaaaacgatattttgccgtttgtcacactttatcattttgat
ttaccttttgcgttggtggaaaaatacaatggttgggcggatcgtcgctgcgtttccgca
tttcaacgctatgcgcaagtctgttatcaagcatttggtgatcgagtcaaaaattggcaa
gttacgaacgaacaaaacttaatgattcgtgttgatgaacgaatgaatatgtacgatgtt
gcaccagaaaatgttgaaaaaattcgtgcacaaatggattaccatatgtttgttgcccat
gcgttagcgacgaatgattgtcaccaattggtcgctgggggaaaagtcggtccctctgtt
tcctcaacgatgacttatcctagttccaataaacctgaggatgtttgggcagctcgtatg
aatgataactttaaaacaaattatgctctagaaatgtattgtcttggcgaataccctggt
tactatcaagagtatttaaccaaatgcggcatttatcccgaaacacagccagaagatcaa
gcaattctgaaagccgctaaaccagattttatcgcccttaattattatcggacgttagtt
gctagctatttaccgacagatgagcaacacccattgggtacgaaagaaaaggacattgat
tttgatctatacggttatttcaaaatcgaaaaaaatcaacatttaaaaacctctaagtat
ggtgcccaaattgatccaactggtctacgtttagttttaaatgattattatcgtcaatac
cgtttaccgttaatcattacagaaaacggcttaggcacaccagatcgcctaacagaggac
ggaaaagttcatgatgactatcgaattgcgtatttgcatgaccatattgctgcttgtcat
gcggctatttctgacggtgttgagttgtttagctattgcccttggtcggtcatggatatt
ttaagttctcatcaaggattcaaaaaacgctacggttttatttacgtcaatcgtgaagac
catgagttaaaagatttacgacgcattaaaaaagatagtttttattggtaccaatcagtg
attaaaaataacggtttaccagaagaataa

DBGET integrated database retrieval system