KEGG   Enterococcus faecalis 62: EF62_2288Help
Entry
EF62_2288         CDS       T01881                                 

Definition
regulatory protein, LacI family protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
efl  Enterococcus faecalis 62
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:efl00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    EF62_2288
Enzymes [BR:efl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     EF62_2288
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2265311..2267224
Genome map
AA seq 637 aa AA seqDB search
MMNIKDIAKLAGVSASTVSKIINNKDQTISKETRERVLKIVRDYNYTPYSANLVTNSTTK
TFVLLLNSHETFEAWVTSFIDKAQENGYNCLILNSHGSLEQELKNITSPTLKQASGIIWD
PINENSKQYAKFIEELTIPYYFVNHSTNELPSLAGLYEEASYVLTQELLQNNHKKISYFV
TNPKYKEAIIAGYKKALFDVNLPFSKENILTTIPADFSNQLITDGITGILTDDYTQAVFL
EQLLKQSGLRTPDNYSLLAIKRKIDRSFLPDHISSVLLDTETFGSQLALSLLNKRKEKTA
LINEAEKLVLDHKNTLGMSSVNPHSKMIVVGSLNVDNYLYSTNLPHNGKTNFLSSYAKFP
GGKGLNQAVGLTKLGHQATLIGCLGSDTDANYLYKELEKYHVTTDGITRIQDTETGQAYI
YVETSGDSMISILPGANTALTPKKIAQQKHLFMDASFCLIQTEIPLSAVEKACEIAQHSG
VPIILKPAAIHHIPVNILEKVDFFIPNEDELLELQPDTGTLEEKAAYFLEMGVKNVIVTL
GKKGVLLKTHQVCHYFPATENIAVDSTGASDSFISALASYLSKGYPTEAAIQIAIQAAGF
SVSKEGVIDSLVDHVTLENYLIKKEPALFAHRNTCVD
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgatgaatattaaagatattgcaaaattagctggcgtttccgcttcaactgtatccaaa
attataaataataaagatcaaactattagtaaagaaacccgtgagcgtgtcttaaaaatc
gttcgagattacaactacacaccttactcagcaaatctcgtcacaaatagtactacaaaa
accttcgtgttattattaaatagccatgaaacttttgaggcttgggttacgagctttatt
gataaagctcaagaaaatggctataactgcttgattttaaatagtcacggtagtttagaa
caagaactgaaaaatattacctcgccaactttaaaacaagccagtggcattatttgggac
ccaatcaatgaaaacagtaaacaatacgcgaaatttatagaagaattaacgattccttac
tattttgtcaatcactcaactaacgaattaccttctctagcggggctttatgaagaagct
agttatgttttaacccaagaattattacagaataaccataaaaaaattagttatttcgtc
actaacccgaaatataaagaagcaattattgcaggctataaaaaagccttatttgatgtc
aatttaccctttagtaaagaaaatattttaactactatccctgctgatttcagtaatcag
cttatcacagatgggattacgggtatccttactgatgactatacccaggctgtttttttg
gaacagcttttaaagcagagcggtttgcgaacccccgataattactctttactcgcaatt
aagcgaaaaattgatcgttcatttttacctgatcatatttcttccgtcttattagataca
gagacgtttggcagccagttagccttatcattgcttaacaaacgcaaagaaaaaacagcc
ttgattaatgaggctgaaaaattggtgctagatcacaaaaatacattaggcatgtctagt
gttaatccacatagcaaaatgattgtagtgggtagtttaaacgttgataattatctgtat
tcaacaaatttaccacataacggcaaaacaaattttctgtctagctatgctaaattcccc
ggcggaaaaggattaaatcaagctgttggcttaaccaaactggggcatcaggccacctta
attggttgtttaggctcagacacagatgcgaattacttatataaagaattagaaaaatac
cacgttacgacagatggtatcacacgtattcaagatactgagactggtcaagcttatatt
tatgttgagacaagcggcgactccatgatttcaatcttacctggtgcaaacacagcgctt
acacctaaaaaaatcgcacagcaaaaacacctatttatggatgccagtttttgtctcatt
caaacagaaattcctttgtctgctgtagaaaaggcttgtgaaatcgcccaacattcaggg
gtaccgattattttaaaaccagctgctattcatcatattccagtgaatatactagaaaag
gttgattttttcattcccaatgaagatgaattattggaacttcaaccagatactggtaca
ttagaagagaaagcggcgtacttcttagaaatgggcgtaaaaaatgtcattgttacttta
ggaaaaaaaggcgtgttattaaaaacacaccaagtgtgccactattttcctgcaacagaa
aatatagctgtggatagcactggtgccagtgacagctttatcagcgcgctcgcctcctat
ctttcgaaaggttatccgactgaagcagccattcaaatagcaattcaggctgcaggattt
tcagtttctaaagaaggggtgattgattctttagttgatcacgtcactttggaaaattat
ttgataaaaaaagaacccgctctttttgctcatcgtaacacctgtgtcgactga

DBGET integrated database retrieval system