KEGG   Enterococcus faecalis 62: EF62_2639Help
Entry
EF62_2639         CDS       T01881                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
efl  Enterococcus faecalis 62
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:efl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    EF62_2639 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EF62_2639 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    EF62_2639 (thrC)
Enzymes [BR:efl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     EF62_2639 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2624819..2625874)
Genome map
AA seq 351 aa AA seqDB search
MYEGLLKQYQAYLPVTEKTPMISLAEGNTPLIPLPNLSKELGIQLYGKYEGLNPTGSFKD
RGMVMAVAKAVEEGAKAIVCASTGNTSAAAAAYATRAGIKAYVVIPEGKIALGKLAQAIM
YGADIISIPGNFDEALKAVREIAKTEAVALVNSVNPYRLEGQKTAAFEVCEQLGQAPDVL
AIPVGNAGNISAYWKGFKEWHEKQGTTLPRMHGFEAEGAAAIVKGQVIEQPETVATAIRI
GNPASWQLAEQARDESGGFIDAVTDQEILTAYRKIAAQDGVFIEPGSAASLAGVIQHVKS
GKIKAGETVVAVFTGNGLKDPDTAMETEVAISKMSDVEEMRLHLRKGVATL
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgtatgaaggtttgttaaaacagtatcaagcgtatttgcccgtaacagaaaaaacacca
atgatttctttagccgaaggaaatacgccactgattcctttacctaatttatccaaagaa
ttaggtattcaattatatggaaaatacgaaggcttaaatcccactggctcattcaaagat
cgcgggatggtgatggctgtagcaaaagcggtagaagaaggtgccaaagcgattgtttgt
gcttctacaggaaatactagtgccgccgctgctgcgtatgccacaagagcaggtattaaa
gcgtatgtagtgattccagaagggaaaatcgcactgggaaaattggcgcaagctattatg
tatggggcagacattatttcgattccaggtaactttgatgaagcattaaaagcggtgcga
gagattgcgaaaactgaggcagttgcgctagttaattcagtgaatccttatcgcttagaa
gggcaaaagacagcagcttttgaagtttgtgaacaattaggtcaagcgcccgatgtctta
gcgattccagttggaaatgccggcaatatttccgcttactggaaaggctttaaagaatgg
catgaaaaacaaggaacaactttaccaagaatgcatggttttgaagcagaaggtgccgca
gcgatcgtgaaaggccaagtgattgagcaacctgaaaccgtggcaacagcgatccggatt
ggaaatcctgctagttggcaactagcagaacaggcacgggatgaatccggtggtttcatt
gatgccgtgacagatcaagaaattttaacggcttaccgaaaaattgctgctcaagatggg
gttttcattgaacctggttcggctgcttcattagctggagttattcaacatgttaaaagc
ggtaaaatcaaagcaggtgaaaccgtcgtggcagtctttactggtaacggactgaaagat
cctgatacagcaatggagacagaagtagctatttcaaaaatgagtgacgtggaagaaatg
cgtctgcacttacgaaaaggagtcgcaacactatga

DBGET integrated database retrieval system