KEGG   Enterococcus faecalis 62: EF62_2753Help
Entry
EF62_2753         CDS       T01881                                 

Definition
hypothetical protein
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
efl  Enterococcus faecalis 62
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:efl00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    EF62_2753
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    EF62_2753
Enzymes [BR:efl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     EF62_2753
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2747869..2749221
Genome map
AA seq 450 aa AA seqDB search
MGIRSHLAIAAGKTSQWVLQTFFKGGSSYPGKLALKIDPKILDTLAKDYEIVVVTGTNGK
TLTTALTVNILRQEFDEVLTNPTGANMEQGIVSTFLNAKAKKGQKKFAVLEIDEASLSRV
TKYIQPKLFVFTNIFRDQMDRYGEIYTTYRLIMEGAAAAPEATILCNGDSPIFNSKETVN
PRKYYGFNHLPPKEQLAHYNTDGVLCPKCNHILHYKMITYANLGDYYCPNCGFKRPELDV
QLTEMVRMDNTSADFVIDGEEYGIAVGGMYNVYNALAATAVAEYYQVAPDKIRAGLAYDE
KVFGRQETIKVGDKECTLVLVKNPVGLNQVIDMMGLAPYSFSLVSLLNANYADGIDVSWI
WDGNHEAFADMDIPKVIAGGDRHEDMALRLKVAGIPEEKLLEIADLEQVISEIKTLPTDH
VYILATYTAVLQLRKSLTAQGYIQGGMNGV
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atggggattcgaagtcatttagcaattgctgcaggaaaaacttcgcaatgggttttacaa
acattttttaaaggcggcagtagctacccagggaaattagccctaaaaatcgatcctaaa
attttagatacattggcaaaagactatgaaattgtcgtagtcactggaacgaacggcaaa
acattgacaactgctttaactgttaacattttacgccaagaatttgatgaggtattaaca
aatccaacgggtgctaacatggagcaaggaattgtctctacttttttaaatgccaaggcg
aaaaaaggacaaaagaaatttgcggtgttagaaattgatgaagcaagtttaagccgtgtc
actaaatatattcaaccaaaattatttgtttttacgaatattttccgcgaccaaatggat
cgctatggtgaaatttatacgacgtatcgcttaattatggaaggcgccgctgctgctcct
gaagcaactattttgtgcaatggtgattcgccaatttttaattcaaaagaaactgtaaat
cctcgcaaatactatggatttaatcatttaccaccgaaagagcaattggctcattacaat
acagatggggttttatgtccaaaatgtaatcatattcttcattataaaatgattacgtat
gctaatttaggtgattactattgcccaaattgtggcttcaaacgccctgaattggatgtg
cagttaacggaaatggtccggatggataatacatctgctgattttgtgattgatggcgaa
gaatacggcattgctgttggtgggatgtataatgtttataatgcgctagcggccacagcg
gtagcagaatattatcaggtggcaccagataaaatccgagcaggcttagcttatgatgaa
aaagtttttgggcgtcaagaaaccattaaagttggcgataaagaatgtacgttagtttta
gtaaaaaatcccgttggtttaaatcaggtcattgatatgatgggcttagccccttactct
ttctcgctggtttcattattaaatgctaattatgcagatggaattgatgtcagttggatt
tgggatggtaatcatgaagcctttgctgatatggacattccaaaagtaattgctggcggt
gatcgccatgaagatatggccttgcgtttaaaagttgcgggtattcctgaagaaaaatta
ctagaaattgctgatttagagcaagtaatttcagaaattaaaacgttgccgacagatcat
gtctatattttggcaacctatactgctgttttgcaattaagaaaatcattaacagcccaa
gggtatattcaagggggaatgaatggtgtctaa

DBGET integrated database retrieval system