KEGG   Enterococcus faecalis 62: EF62_2763Help
Entry
EF62_2763         CDS       T01881                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
efl  Enterococcus faecalis 62
Pathway
efl00230  Purine metabolism
efl01100  Metabolic pathways
Module
efl_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:efl00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    EF62_2763
Enzymes [BR:efl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     EF62_2763
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_18 PPK2 AAA_22 AAA_23 AAA_16 RsgA_GTPase AAA_24 Alpha_L_fucos Gtr1_RagA NB-ARC AAA_28
Motif
Other DBs
NCBI-ProteinID: ADX80971
Position
complement(2759374..2759943)
Genome map
AA seq 189 aa AA seqDB search
MIKQLQHPFFVIMGPSGSGKTAITSKVFPKNYKVISHTTRKKRLDEVDGVDYYFETKASF
QTLIETNQLVEYDFYHGNYYGVGVDAIVETTKEHPAYNALTFPGFQAVFERFGESVIPVF
FDVSKENIYQRLKQRESDPKIIEERLNLYDQEILIKNQLEQYPNYQRIDANGPIKEVAGL
LQECIKHYY
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgattaagcaattacaacatccattttttgttattatgggtccgagtggttctggcaag
accgcaattacaagtaaggtttttccgaaaaactataaagttatctcgcatactacgagg
aaaaaacgattggatgaagtggatggtgtggattactattttgaaacaaaagcaagtttt
caaaccttgattgaaaccaatcagttagtggagtatgatttttaccatggaaactattac
ggtgtcggtgtagatgccatcgttgaaacaacgaaagagcatccagcctataatgcgtta
acttttccaggctttcaagcggtctttgagcgtttcggcgagtccgtcattccagttttt
tttgacgtttcaaaagaaaatatttatcaacgtttaaaacaacgagaatctgatcctaaa
attattgaagaacgtttaaacctttatgatcaagaaattcttatcaaaaaccaattggaa
caatatcctaattatcaacgaatagatgccaatggacctataaaagaggtcgctggcttg
ttacaagaatgcatcaaacactattattaa

DBGET integrated database retrieval system