KEGG   Enterococcus faecalis 62: EF62_2784Help
Entry
EF62_2784         CDS       T01881                                 

Definition
carboxylesterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
efl  Enterococcus faecalis 62
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2778926..2779690)
Genome map
AA seq 254 aa AA seqDB search
MAKKINLPKPLFSEKGKRAVLLLHAYSGSSNDVRMLSRRLEKENYTVYSPNFSGHGTLVP
EDILDQTTEQWWQDTQEAVAFLRERGYQEIAIFGLSMGGIFSMHALTEQLTGLIGGGFFC
SPIYPVENKVPENFVLYAENVMKIAEVPAEEQQSRLQSIEQRVKQQLGAIETIASQTADK
LNKIHAPLFLAQAGKDEMIEPMGVYQTAQALTQARVTLQWYPNSGHVITVSGEHKQLEQD
VVQFLATLPWNEEK
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaaaaaaatcaatttaccgaagccgttattttcagaaaaaggaaaacgggcggtc
cttttattacatgcttattctggcagcagtaatgatgtacggatgttaagcagacgttta
gaaaaagaaaattatactgtctattcgcctaatttttcaggacatggcacgctagttcct
gaagatattttagatcaaacaacggaacaatggtggcaagatacacaagaagcagtcgct
tttttgagagaaagaggctaccaagaaattgccatttttggtttatcaatgggcgggatt
ttcagtatgcatgcattaacggaacaattaacaggattaattggtggtggatttttctgt
tcaccgatctaccctgtcgaaaataaagtcccagaaaatttcgtattatacgcagaaaac
gtgatgaaaatcgcagaagttcctgcagaggaacaacaaagccggttgcaatcgattgag
caacgagtcaaacaacaattaggagcgattgaaacaattgctagtcagacggcagacaaa
ctaaacaaaatccacgcacctcttttcttagcgcaagctggcaaagatgaaatgattgag
ccaatgggcgtctatcaaacggcccaagcgctaacacaagcacgtgtgaccttacaatgg
tacccaaatagcggacatgtcattacggtgagtggagaacacaaacaattagagcaagat
gtggtgcaatttttagcaacactaccttggaatgaggagaaataa

DBGET integrated database retrieval system