KEGG   Enterococcus faecalis 62: EF62_2822Help
Entry
EF62_2822         CDS       T01881                                 

Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
efl  Enterococcus faecalis 62
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:efl03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2819364..2821973)
Genome map
AA seq 869 aa AA seqDB search
MVTLFGEDEEKAFIVGTVQAIFFENPSNFYKVVLVNVTDTNTDYLEKEIVVTGSFGQVQE
EEPYRFFGHFVDHPRYGRQFQVDSYQQERPTSASGVVNYLSSDKFPGIGKRTAEKIVEVL
GESAIDRIIDDPSVLEEVTVLNEKKRQVIVETIRLNHGMEQVIVGLNRYGFGSQLAFSIY
QTYQEETLSVIQENPYQLVEDIEGVGFKRADNIAEQIGIQADSAVRIRAAILHEVFEHSI
RSGNTYVQADVLLEEAIRTLEASRPVEISPDQVANEIITLVEHGKIQQEETKLFENSLYF
SEWGIGTSIQRLLSRKKEIHYEEEEVQKNIRMIEKRLNIQYGDSQQAAIEEAIKSPLFIL
TGGPGTGKTTVINGIVSLFAELNGLSLDLKDYTQEMFPILLAAPTGRAAKRMNETTGLPA
STIHRLLGLTGREKNPSLTAKELEGGLLIVDEMSMVDTWLANTLLKAIPTNMQVIFVGDK
DQLPSVGPGQVLHDLLQINEIPKCELNEIYRQGDGSSIIPLAHEIKEGKLPADFQKNQKD
RSFFASDIGHIEEYIRQIVTKAKAKGFTPQDIQVLAPMYRGAAGIDALNKMMQEIFNPND
GKKKEVKWNDTVYRIGDKVLQLVNTPELNVFNGDMGEIVGITLAKDSEDKVDELVLQFDN
NEVTYKRNEWNKITLSYCCSIHKTQGSEFRMVLLPMVHQYSRMLQRNLLYTAVTRSKELL
ILLGEVSAFETCVKNESASRMTMLKERIVNAEQMTLTTRTQLEAYEEGLTADHPFTEKET
KAVSYETEQQSTKANQIKETDEQLVDTMVQEVSLFADEGEESTPETANKATKVVEEPLPK
EPRLTVEIIQTNAVDPMIGMKDTTPYQFM
NT seq 2610 nt NT seq  +upstreamnt  +downstreamnt
gtggtaacactttttggtgaggacgaagaaaaagcctttattgttggaactgtacaagca
atcttttttgaaaatcccagtaatttttataaagtcgttcttgtaaatgtgaccgataca
aatacagattatttagaaaaagaaattgtagtaactggtagttttggccaagttcaagaa
gaggaaccctatcgtttctttggtcattttgtggaccatcctcgttatggcagacagttt
caggtggatagttatcagcaagaaagaccgacttcggctagtggggtggttaactattta
tcaagtgacaaatttcctggcattggtaaacgaactgctgaaaaaattgttgaagtatta
ggggaaagtgcgattgaccgaattattgatgatccgagtgttttggaagaagttactgtt
ttaaatgaaaaaaaacgtcaagtaatcgtcgaaacaattcgcttgaatcacgggatggag
caagtgattgtgggactaaatcgatacggcttcggtagtcagttagctttttcaatttat
caaacctatcaagaagaaaccctttctgtgattcaagaaaatccttatcagttagttgaa
gatattgagggagtcggatttaaacgagcggacaatattgctgaacaaatcggcattcag
gcggattctgctgttcgaattcgagcggcgattttacatgaagtgtttgagcactccatt
cgctcaggcaatacgtatgttcaagcagatgttttgttagaagaagcgattcggaccttg
gaagcaagtcgcccagtggaaatctcacctgatcaagtggctaatgaaatcattacgtta
gtcgaacatggaaaaatccaacaagaagagactaaactttttgagaacagtctctatttt
tctgaatggggcattggtacttcgattcagcgtttactttctcgtaaaaaagaaattcat
tatgaggaagaagaagtccaaaaaaatatccgaatgattgagaaacgtttaaatattcag
tatggcgactcgcaacaagcagcgattgaagaagcgattaaatcgccgttatttatttta
actggagggcccggaacagggaaaacaactgttattaatgggattgtctcgttgtttgcg
gagctaaatggtctttcattagatctcaaagactatacgcaggagatgtttccaatcttg
ctagcggcgccaactgggcgagcagcgaaacgtatgaacgaaacgacaggtttacctgca
agtaccatccatcgtttgttaggcttgacaggtcgtgaaaaaaatccgagtttaaccgcc
aaagaattagaaggtggtttgctaattgtagatgaaatgtccatggtagatacttggtta
gccaatacgttattaaaagctattccgacaaacatgcaagtgatttttgttggtgataag
gatcagctaccgtctgtcggtccaggtcaagtcttacatgacttattgcaaattaacgaa
attcccaaatgtgagttaaacgaaatttatcgtcaaggagacggttcaagtattattcct
cttgcccatgaaattaaagaaggaaagttgcctgctgattttcaaaaaaatcaaaaggat
cgctcgttctttgcaagtgatattggtcatatcgaagaatacattcgacaaatcgtcaca
aaggcaaaagcaaaagggtttacgccacaagatatccaagttttagcgccaatgtatcgt
ggcgcagccggcattgatgccttgaataagatgatgcaagaaatcttcaatccaaatgat
ggtaagaaaaaagaagtcaaatggaatgacaccgtctatcggattggggacaaagttttg
caactagtcaatacgccagaattaaatgtgttcaatggagatatgggagaaatcgtcgga
attactttagccaaagactcagaggacaaagtggacgagttggttttacagtttgataat
aatgaagtaacgtataaaagaaatgaatggaataaaattacgttatcctattgttgttcg
attcataaaacgcaaggtagtgaattccgcatggtgttactgccaatggttcatcagtat
agccgaatgctgcaacgaaatttgctgtatacagcagtgacacgtagtaaagaattatta
attctattaggtgaggtttctgcttttgaaacatgtgtcaaaaacgaatcggctagtcgc
atgacgatgctaaaagaacgaatcgtgaatgcagaacaaatgaccttaacgactagaacc
cagttagaagcctatgaagaaggtttaacggcagaccatccatttactgaaaaggaaaca
aaagctgtctcttatgaaactgaacagcaatcaacgaaagccaatcagataaaagaaaca
gacgagcaattagttgacacaatggtacaagaagtttcactatttgctgatgaaggggaa
gagtcaaccccagaaacagcaaataaagcgacaaaagttgtcgaagaaccattaccaaaa
gaaccacgactaacagtcgaaattattcaaacaaatgctgttgatccaatgattggaatg
aaggatacgacgccttatcaatttatgtga

DBGET integrated database retrieval system