KEGG   Enterococcus faecalis 62: EF62_2866Help
Entry
EF62_2866         CDS       T01881                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12111  
evolved beta-galactosidase subunit alpha [EC:3.2.1.23]
Organism
efl  Enterococcus faecalis 62
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:efl00052]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:efl00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2868266..2871343)
Genome map
AA seq 1025 aa AA seqDB search
MKTWENYKVDSINRLPGRAHFSSFPSKETALLNENKYTQAYKNLNGCWHFLFLEAPEYSP
ENFFATDFDTSQMDQITVPGNWQVQGYGKMHYSDLWYNFPINPPYVPTENPTGIYKRTFA
IDETFHDKKIILRFCGVDSAYHVWVNGHEVGYSKGARNEAEFDITSYAKIGETNDLTVRV
YQWSDGTYLEDQDMWWLSGIFRDVELLGVPENGLEDFFIISDLDDSYQNGHLAITGKFWQ
DKGQQVQLELMDQQGKTVLKETVAGNQGTVEFSASLPSVTAWSAEKPYLYQLFITVFSEG
EVVEVIPQKVGFRNIHVSGETFLVNGVAIKLKGMNRHDYNPKNGRVVSREEIEKDIRLMK
QFNINAIRTSHYPASAYFYDLCDEYGMYVIDETDLECHGFELTGEYDWISNDPEWETAYV
SRMVRMIQRDKNHPSILFWSLGNESAFGHNFIEMARIAKEMDPTRLVHYEGDFEAEVTDV
YSTMYTWLEHPTRELLMNTIIENSKKPHILCEYCHAMGNGPGNLKEYQELFYAHDKLQGG
FIWEWFDHGIESVTDNGEVYYRYGGDFGDDPSNKDFCIDGMLMPDRTPSPSLYEYKKVIE
PITTSAIDVLSGEFSLLSRFDFENLAIFNLVYTITEDQTVIQSGTVSVPAIAAREEGRLH
LPYHLDFPKKAGAAYYLTLSYQLKETTAYASAGHELATAQFELPITTPGIEITPVGLLMA
KEIGPHLYIEGPNFSINFDKVKGALTNVTRDGKKLLHKGPKFTFWRAPISNDMEIIDEMK
KKYFLHLEHEIVRSFEWKKVDDFIQVIVKTINGTTNSAWHYQCTYQYLIAPNGEIFFDLK
GSPAGKIENAPDMLPRLGVTLHLDKSLSEVKYFGKGPRENYVDSQEAGLLGVYEATVAEM
FTNYVVPQANGNHMATKWSAFTDDRGQGVVATAADSYNFSVSYFEEQTLDVAKHTNELQE
SEYVVLNIDYKQNALGSYSCGQWQLEKYRTTFEEFQLAFRLTPFNNKEIQAADVAHERVK
RPTIS
NT seq 3078 nt NT seq  +upstreamnt  +downstreamnt
atgaagacttgggaaaattataaagtagatagtatcaatcggttgcctggacgagcacat
ttttcgagctttccttcgaaagaaacagcgttattaaatgaaaataaatatacacaagca
tacaaaaatttaaacggatgctggcattttctctttttagaagcgccagaatacagccca
gaaaacttttttgcgacggactttgatacaagccaaatggatcaaatcactgttcctgga
aattggcaagtccaaggatatggcaaaatgcattactctgatttatggtacaattttccc
attaatccgccgtatgtaccaacggaaaacccaacaggtatttacaaacggacatttgct
atagatgaaacatttcacgataaaaaaatcattttacgtttttgtggcgtagattcagct
tatcatgtttgggtgaacggccatgaagttggctacagtaaaggtgcacgaaatgaagca
gaatttgacattacgtcttacgctaaaattggtgaaacaaatgatttaacggtgcgagtc
tatcaatggtcagatggtacgtatttagaggatcaagatatgtggtggttaagtggtatt
tttcgtgatgttgaattactcggtgtaccagaaaatgggctggaagatttctttattatt
tccgatttagatgattcgtatcaaaatggccacttggcaattacgggtaaattttggcaa
gacaaaggacaacaagttcaattggagttgatggatcagcagggaaaaacggttcttaaa
gagactgtcgcaggaaatcaaggtacggttgaattttcagcaagtttaccgtctgtcact
gcttggtcagctgaaaaaccatacttgtatcaactatttatcactgttttttctgaaggg
gaagtcgtcgaagttattccgcaaaaagttggtttcagaaatattcatgtatctggtgag
actttcttagtcaatggtgtggccattaaactaaaaggaatgaatcgtcatgattataat
ccgaaaaatggtcgagtggttagtcgtgaagaaattgaaaaagatattcgtttaatgaaa
caatttaatattaatgccattcgaaccagtcattatccagcatctgcttatttttatgat
ttatgcgatgaatatggaatgtatgtgattgatgaaactgatttggaatgtcacggcttt
gaattaaccggagaatatgattggattagcaacgatccagaatgggaaacggcttatgtt
tctcggatggtacggatgattcaacgggataaaaaccatccatcaattctcttttggtcg
ttaggaaatgaatctgcgtttggtcataactttattgaaatggcccgtattgcaaaagaa
atggatccaacacgtttggttcattatgaaggtgattttgaggcagaggtcacggatgtc
tattctacaatgtatacgtggttggaacacccaactagagaattactgatgaatacgatt
attgaaaattcaaaaaaaccgcatattttatgtgaatattgtcatgcgatggggaatggc
cctgggaatttaaaagaataccaagagctattttatgctcatgataaattacaaggtggc
tttatttgggaatggtttgaccatggcattgaatcggtaacagataacggtgaagtttat
tatcgttatggcggcgatttcggcgatgatccaagtaacaaagatttttgtattgacggg
atgttgatgcctgaccgtacgccatctcctagcctgtatgaatacaaaaaagtcattgaa
cccattacaactagcgctattgacgttctgtcaggtgaattctcattattgagtcggttt
gactttgaaaacttggctatctttaatctggtttatacaattactgaagatcaaacagtg
attcaatcagggacagtatcagtgccagcaattgctgctagagaagaaggaagactgcac
ttaccttatcatttagattttcctaaaaaggcaggagccgcctattatttaactctttca
tatcaattgaaagaaacgaccgcctatgcatctgctggtcatgaattagctaccgcacag
tttgaattgccaattacaacaccagggattgagatcacaccagttggcttgctaatggca
aaggaaattggccctcatttatacattgaaggaccaaacttttcaattaattttgataaa
gtgaagggtgccttaacgaatgtgacacgagatggtaaaaaattattgcataaagggccg
aaatttacattttggcgggcaccgatcagtaatgatatggaaattattgatgaaatgaag
aagaaatatttcttacatttagagcatgaaattgtccgttcttttgagtggaaaaaagtt
gatgattttatccaagtcatcgtaaaaacaattaacggaacgactaacagtgcttggcat
tatcaatgtacctatcagtatttaattgcaccaaatggcgaaattttcttcgacttaaaa
ggtagtcctgctggtaaaattgaaaatgcgccagatatgttaccacgtttgggtgtgact
ctccatttagacaagtctctatcagaagtaaaatatttcggtaaagggccgagagaaaac
tatgtagattcacaagaagctggtttacttggcgtttatgaggctacagtggcggaaatg
ttcactaattatgttgttccacaagccaatggtaaccacatggcgactaaatggtccgca
ttcacggatgatcgcggccaaggggtagtagcaacagcggctgattcatataattttagt
gtttcttattttgaagaacaaacgctagatgttgctaagcataccaatgaattacaagaa
agtgagtatgttgttttaaatatcgattacaaacaaaacgccctaggtagctactcttgt
ggccagtggcaattagaaaaataccggactacgtttgaagaattccaattggcattccgc
ttaacaccttttaataataaagagattcaagcagcggatgtcgcacatgaacgagtaaaa
cgaccaacaatttcttaa

DBGET integrated database retrieval system