KEGG   Enterococcus faecalis 62: EF62_2918Help
Entry
EF62_2918         CDS       T01881                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
efl  Enterococcus faecalis 62
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:efl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    EF62_2918 (recR)
DNA repair and recombination proteins [BR:efl03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      EF62_2918 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2920926..2921522)
Genome map
AA seq 198 aa AA seqDB search
MNYPEPIAKLIESYMKLPGIGQKTATRLAFYTIDMKEEDANAFAKALISVKRDLHFCSIC
GNITEEDPCEICQDKNRDRSIILVVEEPKDVMAMEKMREYQGLYHVLHGVLSPMEGTGPE
DINIASLIKRLHDDEVKEVIIATNATTEGEATAMYLSRLIKPAGITVTRLAHGLSVGSDI
EYADEITLLKAVEGRREI
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgaattatccagaaccgattgcaaaattgattgaaagttatatgaaattaccaggaatt
ggtcaaaaaacagcgacacggcttgctttttatacaattgatatgaaagaagaagatgct
aatgcttttgcaaaagcgctaattagtgtcaagagagatctccatttctgtagtatttgc
ggaaatattactgaagaagatccttgtgaaatttgccaagataaaaatcgtgaccgtagt
attattttagtagtggaagaaccaaaagacgttatggcaatggaaaaaatgcgtgaatat
caaggcttgtatcacgtactccacggggtgctttcaccgatggaaggaacaggaccagaa
gatattaatattgcctctttgatcaaacgattgcacgatgatgaagtgaaagaggtcatt
atagcaaccaacgctaccactgaaggagaagcgacggcgatgtatttatcacggctcatt
aaaccagctggaatcaccgttactcgtttggcacacggcttgtctgtcggcagcgatatt
gaatatgcagacgagataaccttgctaaaagcagtcgaaggacgtcgagaaatttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system