KEGG   Enterococcus faecium NRRL B-2354: M7W_1160Help
Entry
M7W_1160          CDS       T02454                                 

Definition
Dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
efm  Enterococcus faecium NRRL B-2354
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:efm00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:efm00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
984395..984913
Genome map
AA seq 172 aa AA seqDB search
MFISMWAQDKNGLIGKNGLLPWRLPNDMRFFREHTMDRILVMGRKTYEGMGDLSLPYRHI
IVLTTQPNFRTKENAEVMHSIDELLSYSQTISEDIYVSGGSRIFQELLPYTGRIWRTLID
STFEGDTYIGNIDFSDFALIEEYEGITDQENLYAHRFQKWERVKNRVASKEE
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgtttatttccatgtgggcacaagataaaaatggtctgatcggcaaaaatggtttgtta
ccatggcgattgccaaatgatatgcgtttctttcgcgaacatacaatggatcgaatttta
gtgatgggaagaaagacctatgaaggaatgggggatctttcacttccttatcgtcatatc
atcgtgttgacaacgcaaccaaatttccgtacgaaagaaaatgcggaagtaatgcattcg
attgatgaacttttgtcgtatagtcaaacgatctcagaagatatctatgtttcgggtggt
agtcggatttttcaagaacttcttccttacactggtcggatctggcgaacattgatcgat
agcacgtttgaaggcgatacgtatattgggaatattgatttttcagacttcgcccttata
gaggagtatgaggggataacggatcaagaaaatctatatgcccatcgttttcaaaaatgg
gaaagagtaaaaaatagggttgcttcaaaagaagaataa

DBGET integrated database retrieval system