KEGG   Enterococcus faecium NRRL B-2354: M7W_1562Help
Entry
M7W_1562          CDS       T02454                                 

Definition
class II aldolase, adducin protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
efm  Enterococcus faecium NRRL B-2354
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:efm00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    M7W_1562
Enzymes [BR:efm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     M7W_1562
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1412303..1413055
Genome map
AA seq 250 aa AA seqDB search
MSDGRMLFERERQDMARIVRVIFERKNTNVAGGNFSFKTTDDQGKDYIIMTPTMMSEAYL
GEISPAQVLVVEPRTRRIVDGVGHLTREINMHEAMYETNPAIKAVLHAHAPNAMFWATTG
LPMPNLTEATAKVKEIPVMDFEPNCSEELAELTSDYVKKQHLELPHMLLLNSHGVLINTG
GESGIEAIHKALQILDTVEWNAEIAYKQTIFQALGITDGFYSKGEKIGGLEELKHKTAIY
NKSVIAAGGD
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatggacgtatgttatttgagagagaacgacaggacatggcacgtatcgtaaga
gtgattttcgaaaggaaaaacacaaatgtcgcaggagggaatttttcctttaaaaccact
gatgatcaagggaaagactacatcatcatgacgccgaccatgatgtcagaagcctatcta
ggagagatttctcctgcacaggttctagtagtagaaccaagaacgcgtagaatcgttgac
ggagtcggtcatttaactcgtgaaatcaatatgcatgaagcgatgtatgagactaatcca
gctatcaaagctgtcctacatgctcatgcgcctaatgcaatgttctgggcgactactggg
ttgcctatgcctaatttgactgaagccacagctaaagtaaaagagatccctgtcatggac
tttgagcctaattgctctgaagaacttgctgaattgacaagcgactatgtaaaaaaacag
catctcgaattaccgcatatgttgctgctcaactctcatggcgtattgatcaacacaggt
ggagaatcaggaatcgaagctatccataaagcactgcaaatccttgatacagttgaatgg
aatgcagaaattgcctacaagcagacgatttttcaagcattagggattactgacggtttt
tattcaaaaggtgagaaaatcgggggattggaagagttgaaacataaaacggctatttat
aataaatctgttattgcagctggtggagactaa

DBGET integrated database retrieval system