KEGG   Enterococcus faecium NRRL B-2354: M7W_1629Help
Entry
M7W_1629          CDS       T02454                                 

Definition
Dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
efm  Enterococcus faecium NRRL B-2354
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:efm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    M7W_1629
   00670 One carbon pool by folate
    M7W_1629
Enzymes [BR:efm01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     M7W_1629
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1481665..1482192
Genome map
AA seq 175 aa AA seqDB search
MLAAIWAQDENGLIGKEDRLPWRLPNDLKFFKQMTEANTLVMGRKTFEGMGSRPLPNRQT
IVLTRDSSYKAEGVHVMHSVEDVLALEKETDGIFFIAGGSAVYQEFLPFCTILYRTVIHH
VFDGDAYFPPVDWSDWSLINTSQGEMDEKNRYPHQFETYQRNENPVKSGTGELTI
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgttagctgcaatttgggcacaggatgaaaacggattgattggaaaagaagaccgtctt
ccttggcgtttgccaaatgatctgaaattcttcaaacaaatgacagaagcaaatacacta
gtgatgggacgaaaaacattcgaagggatgggtagccgtccgttgccgaatcgtcagacg
attgttttgacgagagattcttcctataaagcagaaggcgtgcatgtcatgcatagtgtg
gaagacgtgcttgctctggaaaaagaaacagacggtatctttttcatcgctggagggtca
gctgtttatcaagaatttctgccattttgtacgatattataccgtacagtcatccatcat
gtattcgatggagatgcttattttccacctgttgactggtctgattggtcactgatcaat
actagtcaaggagaaatggatgaaaaaaatcgttatccgcatcaatttgaaacgtatcag
cgtaatgagaatcctgtaaaaagcgggacaggcgaattgacgatataa

DBGET integrated database retrieval system