KEGG   Enterococcus faecium NRRL B-2354: M7W_2621Help
Entry
M7W_2621          CDS       T02454                                 

Definition
Glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
efm  Enterococcus faecium NRRL B-2354
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:efm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    M7W_2621
  Amino acid metabolism
   00330 Arginine and proline metabolism
    M7W_2621
Enzymes [BR:efm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     M7W_2621
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2528048..2528854
Genome map
AA seq 268 aa AA seqDB search
MRKEIKNAKRIIVKVGTSTLIYPNGNINLAAIDQLAFVLSDLRNRGKEVILVSSGAVGVG
MHKLHLSERPTLIPEQQAAAAVGQAELMNIYNQRFSVYNQQTAQILVTRDVVDYPESRKN
VRNTLEQLLIMDTIPIVNENDTVAVDELDHLTKFGDNDQLSAIMAKLVAADLLIVLSDID
GFYSDNPTTNPEAQMYRYIDKIDEKILAQAGGAGSTFGTGGMQSKLKAASRIFEANSAMI
LANGKNPAIIFDILAGKEVGTLFKEDLK
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaagaaattaaaaatgcaaaacgaattattgtcaaagtaggaacaagtacattg
atttatcccaatggaaatatcaatcttgcggcaatcgatcagttagcttttgtcctttct
gatcttagaaatcggggaaaggaagtgatcttagtctcatcaggagctgtaggcgttggt
atgcataaattacatttgtcagaacgtccgactttgattcctgaacagcaagctgcggcg
gctgttggtcaagccgaactgatgaatatctataatcaaagattcagtgtatataatcaa
cagacggcacagatcctcgtgacaagagacgtggtagattatcctgaaagtcgtaaaaat
gtgaggaatacattggaacagcttttgattatggacacgatccctatcgtgaacgaaaac
gatactgtagcagtggatgaattagatcatctgacaaaatttggcgataatgatcagctg
tcagccatcatggcaaaacttgtcgcggcagaccttttgatcgtcctttctgatatcgac
gggttttattcagataatccgactacaaatcccgaggctcagatgtatcgctatatcgat
aaaatcgatgaaaagattctggcacaagcaggtggtgctggtagcacatttggaacaggc
ggtatgcagagtaaattaaaagccgcttctaggatatttgaagcaaacagcgcaatgatt
ttagcaaatggaaaaaatccggcaattatttttgatattcttgcaggaaaagaagtaggt
actttatttaaggaggacttgaaatga

DBGET integrated database retrieval system