KEGG   Enterococcus faecium NRRL B-2354: M7W_2678Help
Entry
M7W_2678          CDS       T02454                                 

Definition
Putative sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
efm  Enterococcus faecium NRRL B-2354
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:efm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    M7W_2678
Enzymes [BR:efm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     M7W_2678
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2577105..2578790)
Genome map
AA seq 561 aa AA seqDB search
MYTKLLQAIYRDSDLAEKTASMIEQKVSVYQQKKGQAGKLHWDEEDIFLITYGDQFFEEQ
QPTLRTFKKFYQKYLADTFRVVHFLPFFPYTSDDGFSVVNYQAINDRLGTWEDIEEMRSE
TRLMFDFVCNHMSAESTWFQEYLNLNDTYKDFFIDLPLDTDTSSVTRPRTSPLLTTFIDK
NGKEKHVWTTFSEDQVDLNFKNPEVLLKMIDILLFYLEKGASFIRLDAVGFLWKELGTSC
IHLPETHKIIQLFRAIADEAAPGTVLITETNVPHKDNISYFGNGENEAQMVYQFSLPPLT
LQAIRSGNTSKLKEWLKTIDFASKKTTFFNFLASHDGIGLNPVRGILPEKTILELVEQLK
KEGARVNYKKNPDGTTSPYEINATYLDALSSPTDTTEWRSKRFLAAHSFLVTLPGVPAIY
IQSVLGSRNDYKGVEKTGENRKINRQKFLLADIEKELQTDPLRTAVYGELTQMLSIRKKE
KAFHPNSLIYLLDSADSFISFIREAKEEKVLVIHNFSNQSAGYLLPKGDYLDLFSGQIIH
CSQERKLIFQPYEYMWLKIIK
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgtatacaaaacttttacaagcgatttatcgcgactcagatttggctgagaaaaccgcc
tctatgattgaacaaaaagtcagtgtttatcagcagaagaaaggccaggcaggcaaactg
cattgggacgaagaagatattttcttgattacttatggggatcaattttttgaagagcag
caaccaactttgcgtacatttaagaaattttatcaaaagtatttggcagatacatttaga
gttgtacatttcttgccatttttcccatatacatctgatgatggtttctccgttgtaaat
tatcaggcaatcaacgaccgtttgggcacatgggaagatatagaagaaatgagaagcgaa
acacggttaatgttcgactttgtctgcaatcatatgtctgccgaaagtacttggtttcag
gaatatttaaacttgaatgatacgtacaaagatttttttattgatttgccactggataca
gatacaagcagcgtgactagaccaaggaccagcccgttacttacaacgttcattgacaaa
aacgggaaagaaaaacacgtatggacgacttttagcgaagatcaagtagacttgaatttt
aaaaatccagaagttttattgaaaatgatcgatattcttttgttttacttagaaaaaggc
gcttcatttattcgcttggacgctgtgggatttttatggaaagaactaggaacttcttgt
atacacctgccagaaacgcataaaatcatccaattattccgtgcaatcgctgatgaagca
gctccaggaacggtattgatcactgagacaaatgtgccacacaaagataatatcagttat
tttgggaatggcgagaatgaagcacagatggtctatcagttttcgctaccacctttgacc
cttcaagcgattcgttcgggtaatacaagtaagttgaaagaatggttaaaaaccatcgat
ttcgcatcgaaaaaaacaactttttttaattttttagcctcccatgacggtatcggattg
aatccggtacgaggtattctgccggaaaaaacgatccttgaattagtggaacagctgaag
aaagagggtgcccgagtaaactacaagaaaaacccagatggaacgaccagtccatatgag
ataaacgctacgtatctagatgcgttaagttctccaacagatacgacggaatggagaagc
aaacgctttttagctgctcattcatttttggtaacgttaccaggcgtgccggcaatttat
attcaaagtgtgctgggaagtcgaaatgattacaaaggcgtagaaaaaacaggagagaat
cgaaaaatcaatcggcaaaaatttttgttagcagatattgagaaagagttgcagacagat
ccattaagaacagcagtatatggtgaattgacccagatgctatctattcgaaaaaaagaa
aaagccttccatccgaatagtttgatttacttactggactcagcagattcttttatcagt
tttattcgcgaagcgaaggaagagaaagtcttagttatccataatttttccaatcaatca
gcaggttatcttttaccaaaaggagattacctagacctgttttctggacaaattatccat
tgcagtcaagaacgaaagttgatattccagccgtatgaatatatgtggctgaaaataata
aaataa

DBGET integrated database retrieval system