KEGG   Enterococcus faecium NRRL B-2354: M7W_427Help
Entry
M7W_427           CDS       T02454                                 

Definition
Alcohol dehydrogenase Acetaldehyde dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
efm  Enterococcus faecium NRRL B-2354
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:efm00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    M7W_427
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    M7W_427
   00620 Pyruvate metabolism
    M7W_427
   00650 Butanoate metabolism
    M7W_427
  Lipid metabolism
   00071 Fatty acid degradation
    M7W_427
  Amino acid metabolism
   00350 Tyrosine metabolism
    M7W_427
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    M7W_427
   00626 Naphthalene degradation
    M7W_427
Enzymes [BR:efm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     M7W_427
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     M7W_427
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
201198..203795
Genome map
AA seq 865 aa AA seqDB search
MAKVMEKEKTKTIDVQAMIDDLAEKANAALKEMESFDQEKVDHIVHEMAMAALDQHMPLA
KMAVEETGRGVYEDKAIKNMYASEYIWHNIKHDKTVGVINEDVQKGLIEIAEPVGVVCGV
TPTTNPTSTTIFKSMIALKTRNPIVFAFHPSAQKSSAEAARVVRDAAIAAGAPENCIQWI
EHPSIEATSMLMNHPGIAIVLATGGAGMVKSAYSTGKPALGVGPGNVPAYIEKTAKIKRA
VNDLIVSKTFDNGMICASEQAVIVDKEIYAAVKAEFQAHQVYIVKPDELQKLEDAVMNEG
KYAVNPSIVGHSAMEIAKLAGISVPKGTKMLIAELEGVGPDYPLSREKLSPVLAMIKANN
TDHAFDLCEGMLNLGGLGHTAVIHSENEELHVKFGLRMKACRILVNTPSAEGGIGDIYNE
MIPSLTLGCGSYGKNSVSRNVSAVNLINVKTVAKRRNNMQWFKLPPKIFFEKNSLLYLEK
MENVERVMIVCDPGMVQFGYCDTVREVLARRKNDVKIEVFSDVEPNPSTNTVYAGTKLMA
DFKPDTVIALGGGSAMDAAKGMWMFYEHPDTSFFGAKQKFLDIRKRTYKIDKPEKTQFVC
IPTTSGTGSEVTPFAVITDSETHVKYPLADYALTPDVAIVDPQFVMSVPASVTADTGMDV
LTHAIESYVSVMASDYTRGLSLQAIKLVFDYLEKSVKTPDMESREKMHNASTMAGMAFAN
AFLGICHSVAHKIGGEYGIPHGRTNAILLPHIIRYNAKDPQKHAMFPKYDYFRADTDYAD
IAKFLGLKGETTEELVEALATAVYELGKSVGINMSLKAQGVTQETLDTTVDRMAELAYED
QCTTANPKEPLISELKQIIIDAYNG
NT seq 2598 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagtaatggaaaaagaaaaaacgaagacaattgacgtacaagcaatgattgat
gatttggcagaaaaagcaaatgcagcattgaaagaaatggaaagctttgatcaagaaaaa
gtagaccatatcgtgcatgaaatggcaatggcagctttggatcaacatatgccattagcg
aagatggctgtagaggaaacaggccgcggtgtttacgaagataaagcaatcaaaaatatg
tatgcgtccgaatatatttggcataatatcaaacatgataaaacagttggtgtgatcaat
gaagatgtccaaaaagggttgattgaaattgctgaaccagtcggtgtggtttgcggagta
actccaacaacgaatccgacttccacaacgattttcaaatcaatgatcgcgttgaaaaca
agaaatccaatcgtttttgctttccatccaagtgcccaaaaatcttctgcagaagcagca
cgagtggtacgtgatgctgctatcgctgccggagctcctgaaaattgtatccaatggatc
gaacatccttcgatcgaagcgacttctatgctaatgaaccatccaggtatcgcgatcgtc
ttagcgacaggtggagctggaatggtcaagtctgcttactctacaggaaaaccagcttta
ggtgtaggtccaggtaacgtaccagcttatattgaaaaaacagcaaaaattaaacgtgca
gtgaacgatttgatcgtttcgaaaacatttgataatggaatgatttgtgcttctgaacaa
gctgtgatcgtggataaagaaatctatgcagcagtaaaagcagaattccaagcacaccaa
gtttatatcgtaaaaccagatgaattgcaaaaattagaagatgcagtgatgaacgaagga
aaatatgcggtcaatccatcaatcgttggacattctgcgatggaaatcgcaaaattggca
ggaatcagtgtaccaaaaggaacgaaaatgctgattgctgaattggaaggcgtaggccca
gattatccgctatcaagagaaaaactttctccagttcttgccatgatcaaagctaacaac
acggaccatgcgtttgatttgtgtgaaggtatgttgaatcttggagggttaggacataca
gcagttatccattcagaaaacgaagagttgcatgtcaaattcggtcttcgaatgaaagct
tgtcgtattttagtgaatacaccatctgcagaaggcggcatcggtgatatctataacgaa
atgattccgtcattgactttgggatgcggttcttatggtaagaactctgtttctcgtaac
gtctctgctgtaaacttaatcaatgtcaaaactgtagcgaaacggagaaataacatgcaa
tggttcaaattaccgccaaaaatcttctttgaaaagaactctctattgtacttagagaaa
atggaaaacgttgaacgtgtcatgatcgtttgtgaccctggtatggtccaattcggttac
tgcgatacagttcgtgaagtattggcacgacgtaaaaatgatgtgaagatcgaagtcttc
tcagatgttgaaccgaacccatcgacaaataccgtatacgcaggaacgaaactgatggca
gacttcaagccagatacagtaatcgctcttggaggcggttctgcaatggacgcagctaag
ggaatgtggatgttctatgaacacccagacacatctttctttggtgcaaaacaaaaattc
ttggatatccgtaaacggacatataagatcgacaaaccagaaaaaacacaattcgtatgt
atcccgacaacatcagggactggttctgaagtaacgccatttgcggtcatcactgacagt
gaaacacatgtgaaatatccgttagcagattatgcattgacgccagatgtcgcaatcgtc
gatcctcaattcgtcatgtcagttccagcatctgtcacagcagataccgggatggatgtg
ttaacacatgcaatcgaatcctatgtttcagtcatggcttcagattatacacgtggattg
agcctacaagcaatcaagttagtctttgactatttagaaaaatcagtaaaaacacctgat
atggaatcacgtgaaaaaatgcacaacgcttctacaatggctggtatggcgtttgctaac
gcattcctaggtatttgtcactcagtcgcacataaaatcggcggggaatacgggatccct
catggacggacaaatgcgattcttttaccgcatattatccgctataatgcaaaagatcca
caaaaacatgcgatgttccctaaatatgactatttccgtgcagatacagattacgcagat
atcgcaaaattcttaggtctgaaaggcgaaacaacagaggaattagtcgaagctttagca
acggctgtttatgaattaggaaaatctgtcggcatcaacatgagtctaaaagctcaagga
gtcacacaagaaacactagatacaaccgtagaccgtatggctgaattagcttacgaagac
caatgtacgacagctaatccgaaagaaccattgatctctgaattgaaacagatcatcatt
gatgcttacaacggataa

DBGET integrated database retrieval system