KEGG   Enterococcus faecium NRRL B-2354: M7W_944Help
Entry
M7W_944           CDS       T02454                                 

Definition
Carboxylesterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
efm  Enterococcus faecium NRRL B-2354
Brite
Enzymes [BR:efm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     M7W_944
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
759492..760238
Genome map
AA seq 248 aa AA seqDB search
MRQLPKPLYAKHGKRAVLLLHAYSGSPNDVRMLARFLEKADYTVYAPLFKGHGTMEPYDI
LQEKAESWWADTKKAIHFLQSEQFSDIAVLGLSMGGIFAVRALEEESVIGGGFFCSPLSP
VKTNVPENFEKYVRQVLKTAGKSEKEINEKAVAYRSLAEQQLMDIQDQAAIVESRLSDIQ
QPIFLAQAGKDEMIDPNGVFETARKLSRQRVTLQWYPESGHVITVGTARRELEKDVLEFL
EKLPWNEE
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
gtgagacaattaccaaaacccctttatgcaaaacatggaaagcgagcggttttgctgctt
cacgcttactcaggaagtccaaacgatgttcgaatgctcgcacgatttttggaaaaagca
gattatacagtttatgcgccgctttttaaaggacacggaacaatggagccatatgatatc
ttgcaagaaaaagcagaaagctggtgggcagacactaaaaaagccatccattttttacag
tctgagcagttttctgatattgccgtattaggattatcaatgggcggcatctttgctgta
cgagcactagaagaagaatcagtgattggcggcggttttttctgttcgcctttgtctcct
gtaaaaacaaacgtgcctgaaaactttgaaaaatacgtacgtcaagtgctgaagacagca
ggtaaatcagagaaagaaatcaatgaaaaagcagttgcttaccgctcgttagctgaacaa
caattaatggatatacaagatcaggcagcaatcgtagaaagtaggttgtcagatatccaa
cagccgatatttttagctcaagctgggaaagatgaaatgatcgaccctaatggcgtattt
gaaactgcacgcaagttgagccgtcagcgagtgacacttcaatggtatcctgaaagtggt
catgtgattacagttggtacagcaagacgcgaattagaaaaagacgtcttggaattttta
gaaaaattaccttggaatgaggaataa

DBGET integrated database retrieval system