KEGG   Enterococcus faecium NRRL B-2354: M7W_955Help
Entry
M7W_955           CDS       T02454                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
efm  Enterococcus faecium NRRL B-2354
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:efm00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    M7W_955
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    M7W_955
Enzymes [BR:efm01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     M7W_955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
770673..771974
Genome map
AA seq 433 aa AA seqDB search
MEEIIVRGGNQLNGTVRIEGAKNAVLPILAASLLAEEGITTLDNVPILSDVFTMNQVIRH
LNVDVDFDEQKNQVTIDASRQLEIEAPYEYVSQMRASIVVMGPLLARNGHAKVAMPGGCA
IGKRPIDLHLKGFQALGAKIIQKNGYIEAIADELIGNTIYLDFPSVGATQNIMMAAVKAK
GTTIIENVAREPEIVDLANILNKMGAQVYGAGTETMRIEGVDHLHAVNHSIVQDRIEAGT
FMVAAAMTQGNVLIADAISEHNRPLISKLIEMGAEIIEEEGGVRVIGPKHILPTDVKTMP
HPGFPTDMQAQMTAIQLVAEGTSVVTETVFENRFQHLEEMRRMNAHVKIDGNVAIMDGNH
ELQGAEVYATDLRAAAALVLAGLKANGITRVRNLNYLDRGYYNFHIKLQQLGADVERVDM
DQTSAEKTAQTIA
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atggaagagatcatcgtaagaggtggcaatcaattaaatggaacagtaagaattgaagga
gctaaaaatgctgttttgcctattttagctgctagtttgttagcagaagaaggtattacg
acattagacaacgttccgattctttctgatgtcttcactatgaatcaagtgattcgtcac
ttaaacgtagatgtagattttgatgaacaaaagaatcaagtaacaatcgacgcttcaaga
caattagaaatcgaagcgccttatgagtatgttagtcaaatgcgtgcttcaatcgttgtg
atgggtccgctacttgccagaaatggacatgcaaaagtagctatgcctggtggatgtgcg
attggtaaacgaccaatcgatttgcatttaaaaggatttcaagctttaggagcaaaaatt
attcaaaaaaacggctatatcgaagcaattgcggatgaattgatcggtaacacgatttat
ttagatttccctagtgtaggtgctactcaaaatatcatgatggctgccgtaaaagcaaaa
ggaacaaccatcattgaaaacgtagctcgcgaaccagaaatcgttgatttagcaaacatt
ttgaataaaatgggcgctcaagtctatggagctggtactgaaacaatgcgtattgaaggc
gtggatcatttacatgcagtcaaccactcaatcgtacaagatcgtatcgaagcaggtacc
tttatggttgctgctgcaatgacacaaggcaatgtgctgattgcagatgctatctctgaa
cataaccgcccattgatttctaaattgatcgaaatgggtgcagaaatcattgaagaagaa
ggcggagtccgtgtcatcggaccaaaacatatcttacctacagatgtaaaaacgatgcct
catcctggtttccctacagatatgcaagctcaaatgacagctatccaattagttgcagaa
ggtacaagtgtagtgactgaaacagtatttgaaaatcgtttccaacatttagaagagatg
cgccgtatgaacgctcatgtcaaaatcgacggaaatgtagcaatcatggatggaaaccat
gaattgcaaggtgcagaagtatatgcaacagacttgcgggcagcagcagcattagtttta
gctggcttgaaagcaaatggaatcacacgtgtgcgtaacttgaattatctagaccgtgga
tattataatttccatatcaaactacagcaattaggtgcagacgttgaacgtgtagacatg
gatcaaacttctgctgaaaaaacagcacaaacgattgcttaa

DBGET integrated database retrieval system