KEGG   Enterococcus faecalis Symbioflor 1: EFS1_0039Help
Entry
EFS1_0039         CDS       T02399                                 

Gene name
proB
Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
efs  Enterococcus faecalis Symbioflor 1
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:efs00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    EFS1_0039 (proB)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    EFS1_0039 (proB)
Enzymes [BR:efs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     EFS1_0039 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(48242..49057)
Genome map
AA seq 271 aa AA seqDB search
MRNKLQQAKRIVIKVGTSSLIYPNGNINLKAIDQLAFTLSDLSNQGKEIILVSSGAIGVG
LNKLNLSVRPTTIPEQQAVAAVGQAELMNIYNQRFSTYSQQMAQVLLTRDVIEYPESRNN
VTNTFEQLLKMNIIPIVNENDTVAIEELDHLTKFGDNDQLSAIVCQIVQADLLVMLSDID
GFFSDNPTVNKEATLFSEINEINEDLFQLAGGKGSRFGTGGMSSKLKAAERVLANQQAMI
LANGKQPKIIFEILEGKDIGTLFIKGGHESD
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgagaaacaaactccaacaggccaaacgaattgtgatcaaagtcggaaccagttctctg
atttatcccaatggcaatattaacttaaaagcaattgatcaattagcctttactttgagt
gatttaagcaaccaaggcaaagaaattattttagtttcttctggcgcaattggtgtcgga
ctgaataaattaaatctatctgtgcgcccaacgacaattcccgaacaacaggcagtcgct
gcagtcggccaagcagaattaatgaacatttataatcagcggttttcaacctatagccaa
caaatggcacaagttttattaactcgtgatgttattgaatatcctgaaagtcgcaataat
gttaccaatacttttgaacaactgttaaaaatgaatattattcctatcgtcaatgaaaat
gatactgtcgcaattgaagaattggatcacttaaccaagttcggggataacgatcaattg
tctgccattgtctgccaaattgttcaagctgacttgttagttatgttatcagatattgat
ggtttcttttcagacaaccctactgtcaacaaagaagccacgttattttctgaaatcaat
gaaattaatgaagacttgttccaattagccggtggtaagggaagccgctttggcactggt
gggatgtctagtaaattaaaagctgctgaacgtgtgttagctaatcaacaggcgatgatt
ttagcaaacggaaagcagccaaaaatcatttttgaaattttagaaggaaaagatatcggt
acgttatttattaaaggagggcatgaaagtgactga

DBGET integrated database retrieval system