KEGG   Enterococcus faecalis Symbioflor 1: EFS1_0107Help
Entry
EFS1_0107         CDS       T02399                                 

Definition
glycosyl hydrolase, family 20
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
efs  Enterococcus faecalis Symbioflor 1
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:efs00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    EFS1_0107
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    EFS1_0107
Enzymes [BR:efs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     EFS1_0107
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
124370..126877
Genome map
AA seq 835 aa AA seqDB search
MNGVQKGMVFKVGNNLSTRKGENRETIVSWLGLSLLVGLAFILFSLFHQPMISQANEPTQ
EKHFMVYYRAWRDKTMQGVNTTLPDENWLTMHDIPYGIDIVNVFSYVPKGQEALAQPFYD
TLKNEYAPALHARGVRLVRGIDYSELLKVPYAGTTPTEAEFDAYAKELLTKFVDDLGIDG
LDIDMETRPSEKDIVLSNGVIRALSKYIGPKSGTDRPFLYDTNAEYLPPLQDVSDCFDFL
AYQQYGSDDQRTQRALNNLSPVLNGERFVPGLTFPEEQDRNRWYDTKEPYMESNMYKVAR
YSYENNLGGMFLYALDRDGRTYNEDDLNQIKPSNLLWTKTAIAESKGVSLAEMKAAAQHY
LKRISYANTDLEAQNKAAEAVTQATTLYDVNKAILGGDYGQGISNTYDAELEKGLLAIDL
TTLYRALDQAVTAIEKAESYTPETIQALQTTKETVATELAGKTYTAAQVTTWQTEVQTAL
DNLKEKQTQPLKSVFSIDAGRKYFSVEQLEELVAKASQNGYTDVQLILGNDGLRFILDDM
SVNVNGKKYNHNRVSKAIQRGNNAYYNDPNGNALTQKEMDRLLAFAKARNINIIPVINSP
GHMDALLVAMEKLAIKNPAFDGSKRTVDLGNQKAVNFTKAIISKYVAYFSAHSEIFNFGG
DEYANDVDTGGWAKLQSSGRYKDFVAYANDLAKIIKDAGMQPMSFNDGIYYNSDDSFGTF
DPEIIISYWTAGWSGYDVAKPEYFVQKGHKIFNTNDAWYWVAGNVDSGIYQYDDALANMS
KKAFTDVPAGSPNLPIIGSIQCVWYDDPRRDYDFERIYTLMDTFSENYREYMVVK
NT seq 2508 nt NT seq  +upstreamnt  +downstreamnt
atgaacggagtgcagaaaggaatggtgttcaaagtggggaacaatttatcgacaagaaaa
ggagaaaacagagaaacaattgtcagttggctgggtctttcgttattggttggcttggcg
tttatcttatttagtctgtttcatcaaccaatgatcagccaagccaatgagccgacccaa
gagaaacattttatggtttattatcgggcttggcgtgacaaaacgatgcaaggagttaat
acaacattgccagatgaaaattggctaacgatgcacgatattccttatggtattgacatt
gtgaatgtctttagttatgtgccaaaaggacaagaagcacttgcacagccattttatgat
acgttaaaaaatgagtatgcgccagcactgcatgcacgaggtgttcgtttagttcgtggg
attgattacagcgagctattaaaagttccttacgcaggaacaacgcctacagaagcagaa
tttgatgcttatgcgaaagagttgttaaccaaatttgtcgatgatttaggaattgatggg
ttagatattgacatggaaactcgtccaagtgaaaaagatattgttctatctaatggtgtc
attcgtgcattatcaaaatacattggaccgaagtcgggaacggatcgtccatttttgtat
gataccaatgcagaatatttaccacctttacaagatgtcagtgactgtttcgattttctc
gcgtatcaacagtatggcagcgatgaccaacgcacgcaacgagcattaaataatttaagt
ccggttctcaatggggaacgatttgttccaggattaactttcccagaagagcaagatcgc
aaccgctggtatgacacaaaagagccgtatatggaaagtaacatgtataaagtagctcgt
tattcttatgaaaataatttagggggcatgttcctctatgccttagatcgcgatggtcgc
acctataatgaagacgatttaaatcagataaaaccttctaatttactttggacaaaaacg
gccattgcagagagtaaaggcgtttctcttgcagagatgaaagcggctgcgcaacactat
ttaaaacgaattagctacgccaacacagaccttgaagcacaaaataaagccgcagaagca
gtgacacaagcaacaacgctttatgatgtgaataaagctattttaggtggcgattatggc
caagggatttcaaatacctatgatgctgaattagaaaaaggcctgttagccattgactta
accactttatatcgtgcgttggatcaagcagttacagccattgaaaaggcagaaagctat
acaccagaaacgattcaagcactacaaacaacaaaagagacagtcgcaacagaacttgcg
ggaaaaacgtatacagccgcgcaagtgactacttggcaaacggaggtccaaacagctttg
gataatttaaaagagaaacaaacacaacctttaaaaagtgtcttctccattgatgcggga
agaaaatatttttccgtggagcaactggaagaattagtggccaaagccagtcaaaatggg
tacacagatgtccaattaattttaggaaatgatggcttacggtttatcttggatgatatg
tcggtcaatgtgaatggtaaaaaatacaaccacaaccgggtttcaaaagcaatccaacga
ggcaacaacgcgtattacaatgatcctaatggcaacgcgttaacacaaaaagaaatggat
cggttgttggcttttgcgaaagcgcgcaacatcaacatcattcccgtgattaacagtcca
ggacatatggatgccttgttagtggccatggaaaaactagcgattaaaaatcccgctttt
gatggctcaaaacgaacagtagatttagggaaccaaaaggcagtgaatttcacaaaggcg
attatcagtaagtacgtggcttatttttccgcgcatagtgaaattttcaattttggtggc
gatgagtatgcaaatgatgtcgacacaggcggttgggcgaaactgcaatcttctgggcgc
tacaaggattttgtcgcttatgcgaatgatttagctaaaataattaaagatgcgggcatg
cagccaatgagcttcaatgatggcatttattacaacagcgacgattctttcggtacattt
gacccagagattattatttcttattggacagccggttggagtgggtatgacgtagccaaa
cctgagtactttgttcaaaaaggacacaaaatttttaataccaatgatgcgtggtattgg
gtagctggcaatgttgattctggcatttatcaatatgatgatgctttagcaaatatgtcg
aaaaaagcatttacagatgtgccagcaggtagcccaaatcttccaattattggaagtatt
caatgtgtttggtatgatgaccctcgtcgtgactatgattttgaacgaatttatacgcta
atggatacgttctcggaaaattatcgtgagtatatggtggttaaataa

DBGET integrated database retrieval system