KEGG   Enterococcus faecalis Symbioflor 1: EFS1_0211Help
Entry
EFS1_0211         CDS       T02399                                 

Definition
glycosyl hydrolase family 1 protein
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
efs  Enterococcus faecalis Symbioflor 1
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:efs00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
227989..229158
Genome map
AA seq 389 aa AA seqDB search
MGFKCFRLSIAWSRICPNGTKEINEEGLAFYDKVFDALLRNGIEPVVTINHFDIPMYLAD
EYDGWKNREVIDFFVFFCETIFTRYQDKVKYWMTFNEINFLRSWTQIGIHNNDKQSKYQA
AHHLFVASAKAVELGHSINPDFQIGMMVAYIPSYPLSCKPEDVMAAVQFNREQEFYMDVQ
AKGYYPAHKLKEFEREGMTIQMESEDLAIIQKGTVDYIGFSYYMSTVSTAYPEEVKYVGG
NQMPAVKNPYLQESEWGWAVDPLGLRISLCQLSDRYNMPLFVVENGFGAVDTLQEDGSIV
DDYRIDYFKQHIEAMRTAVEEDGVNLIGYTPWGCIDLVSAGTGEMKKRYGFIYVDMDDEG
QGTLKRTKKKSFNWYKQVIASNGENLITE
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgggtttcaaatgttttcggctgtctatcgcctggagccggatttgcccaaatggaaca
aaagagattaatgaagaaggcttagccttttatgataaagtttttgatgctttgctacgc
aatggaattgagcccgttgtgacgattaaccattttgatattccgatgtatttggccgat
gaatatgatggttggaaaaatcgtgaagtgattgatttctttgttttcttttgcgaaacc
atttttacgcgttatcaggataaagtgaagtattggatgacttttaatgaaattaatttt
ttaagaagttggacgcaaattgggattcacaataatgataaacaaagtaaatatcaagca
gcgcatcatctatttgtagcaagtgcgaaagcagttgaattaggacattccatcaatcca
gatttccaaattggtatgatggtggcttatattccaagttatcctttgtcctgcaaacct
gaggacgtgatggcagctgttcaatttaaccgagagcaagaattttatatggatgtccag
gctaagggctattatccagcgcataagctcaaagaatttgagcgtgaaggaatgacaatt
caaatggagtcagaggatttagcgattattcaaaaaggaacagttgattatatcgggttt
agttattatatgtcgactgtttcgactgcttatcccgaagaagtaaaatatgtcggaggc
aaccaaatgcctgcggttaaaaatccttatttgcaagaatctgaatggggctgggctgtc
gatcctttagggttaagaatttcattgtgtcagttgtcagatcgttacaatatgccattg
tttgtggttgaaaacgggtttggtgcggtggatacattgcaagaggatggctcgattgtc
gacgattaccgcattgattattttaaacaacatattgaagccatgagaaccgcagtagaa
gaagacggggttaacttaattggttatacgccatggggttgtattgacttagtttcagca
gggactggcgaaatgaaaaaacgttacggttttatctatgtagacatggatgacgaaggt
cagggaaccttgaaacgaactaagaaaaaatcatttaattggtacaaacaagttatcgct
agtaatggtgaaaacttaataactgagtag

DBGET integrated database retrieval system