KEGG   Enterococcus faecalis Symbioflor 1: EFS1_1333Help
Entry
EFS1_1333         CDS       T02399                                 

Gene name
dfrA
Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
efs  Enterococcus faecalis Symbioflor 1
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:efs00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:efs00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
1379346..1379840
Genome map
AA seq 164 aa AA seqDB search
MLAAIWAQDEQGVIGKEGKLPWHLPNDLKFFKEKTIHNTLVLGRATFEGMGCRPLPNRTT
IVLTSNPDYQAEGVLVMHSVEEILAYADKYEGVTVIGGGSVVFKELIPACDVLYRTMIHE
TFEGDTFFPEIDWSVWEKVATVPGVVDEKNLYAHDYETYHRNDK
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgttagcagccatttgggcccaagatgaacaaggagtgattggtaaagaaggcaaattg
ccttggcatttacccaacgacttgaaatttttcaaggaaaaaacaattcataatacattg
gtcttaggacgtgcaactttcgaaggcatgggatgtcgtccgttaccaaatcgaacaacg
attgttcttaccagtaatccggattaccaagctgaaggcgttttggttatgcattccgta
gaggaaattcttgcgtatgctgacaagtatgaaggcgtgaccgttattggtggaggttct
gtcgtttttaaagaactgattcccgcatgcgatgtcttatatcggacaatgattcatgaa
acgtttgaaggcgacactttctttccagaaatcgactggtctgtttgggaaaaagttgcc
actgttcccggcgtcgtggacgagaaaaatctctatgcacatgactatgaaacgtatcat
cgaaacgataaataa

DBGET integrated database retrieval system