KEGG   Enterococcus faecalis Symbioflor 1: EFS1_1360Help
Entry
EFS1_1360         CDS       T02399                                 

Definition
beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase, putative
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
efs  Enterococcus faecalis Symbioflor 1
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:efs00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1409359..1410768)
Genome map
AA seq 469 aa AA seqDB search
MVKQFKNDFLWGASSSAFQIEGAWNEDGKGLTVADYNSFKKSAVQADTKVASDFYHRFKE
DIALMKELGLKTYRFSLSWARIIPTGDGEINQAGIDFYNAVIDTLLENDILPFVTLYHFD
LPFALVEKYNGWADRRCVSAFQRYAQVCYQAFGDRVKNWQVTNEQNLMIRVDERMNMYDV
APENVEKIRAQMDYHMFVAHALATNDCHQLVAGGKVGPSVSSTMTYPSSNKPEDVWAARM
NDNFKTNYALEMYCLGEYPGYYQEYLTKCGIYPETQPEDQAILKAAKPDFIALNYYRTLV
ASYLPTDEQHPLGTKEKDIDFDLYGYFKIEKNQHLKTSKYGAQIDPTGLRLVLNDYYRQY
RLPLIITENGLGTPDRLTEDGKVHDDYRIAYLHDHIAACHAAISDGVELFGYCPWSVMDI
LSSHQGFKKRYGFIYVNREDHELKDLRRIKKDSFYWYQSVIKNNGLPEE
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggttaaacaatttaagaacgattttttatggggcgcttcttcctccgcttttcaaatt
gagggcgcttggaatgaggacggcaaaggcctaacagtcgctgattacaattcttttaaa
aagtcagctgtacaagcagatacgaaagtcgccagcgatttttaccatcgtttcaaagag
gacattgcgttaatgaaagaattaggcttaaaaacctatcgtttttctctttcatgggca
cgaatcattccaacaggtgatggcgaaatcaatcaagccggcatcgatttttataatgct
gtcattgatacacttttagaaaacgatattttgccgtttgtcacactttatcattttgat
ttaccttttgcgttggtggaaaaatacaatggttgggcggatcgtcgctgcgtttccgca
tttcaacgctatgcgcaagtctgttatcaagcatttggtgatcgagtcaaaaattggcaa
gttacgaacgaacaaaacttaatgattcgtgttgatgaacgaatgaatatgtacgatgtt
gcaccagaaaatgttgaaaaaattcgtgcacaaatggattaccatatgtttgttgcccat
gcgttagcgacgaatgattgtcaccaattggtcgctgggggaaaagtcggtccctctgtt
tcctcaacgatgacttatcctagttccaataaacctgaggatgtttgggcagctcgtatg
aatgataactttaaaacaaattatgctctagaaatgtattgtcttggcgaataccctggt
tactatcaagagtatttaaccaaatgcggcatttatcccgaaacacagccagaagatcaa
gcaattctgaaagccgctaaaccagattttatcgcccttaattattatcggacgttagtt
gctagctatttaccgacagatgagcaacacccattgggtacgaaagaaaaggacattgat
tttgatctatacggttatttcaaaatcgaaaaaaatcaacatttaaaaacctctaagtat
ggtgcccaaattgatccaactggtctacgtttagttttaaatgattattatcgtcaatac
cgtttaccgttaatcattacagaaaacggcttaggcacaccagatcgcctaacagaggac
ggaaaagttcatgatgactatcgaattgcgtatttgcatgaccatattgctgcttgtcat
gcggctatttctgacggtgttgagttgtttggctattgcccttggtcggtcatggatatt
ttaagttctcatcaaggattcaaaaaacgctacggttttatttacgtcaatcgtgaagac
catgagttaaaagatttacgacgcattaaaaaagatagtttttattggtaccaatcagtg
attaaaaataacggtttaccagaagaataa

DBGET integrated database retrieval system